BLASTX nr result
ID: Ophiopogon27_contig00026773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00026773 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK69623.1| uncharacterized protein A4U43_C05F24940 [Asparagu... 67 6e-12 >gb|ONK69623.1| uncharacterized protein A4U43_C05F24940 [Asparagus officinalis] Length = 68 Score = 66.6 bits (161), Expect = 6e-12 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -3 Query: 415 VCGIEGGKGAWRVVRSLSCKGSDSAFDVNVTAPLRKMSGSG 293 VCG GGKGAWRV++SLSCKGS+SA DV+VT PLR +S SG Sbjct: 26 VCGSRGGKGAWRVIQSLSCKGSESAVDVSVTVPLRTLSCSG 66