BLASTX nr result
ID: Ophiopogon27_contig00026596
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00026596 (541 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK81919.1| uncharacterized protein A4U43_C01F34270 [Asparagu... 65 2e-09 ref|XP_020268541.1| uncharacterized protein LOC109843932 [Aspara... 65 8e-09 >gb|ONK81919.1| uncharacterized protein A4U43_C01F34270 [Asparagus officinalis] Length = 227 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/61 (50%), Positives = 47/61 (77%) Frame = -2 Query: 186 LQLPFNLSEATKNTTLSKEWINDHLLKVELFRFSIIKKEIKLAASVLQNS*SLQPLKIDP 7 +QLP +L+++ K T + KEW++ HL +VELF+F + KKEIK A ++L N+ SL+ +KIDP Sbjct: 132 VQLPGHLNDSAK-TKVPKEWVHHHLKEVELFQFGVYKKEIKFATNLLHNAKSLELMKIDP 190 Query: 6 R 4 R Sbjct: 191 R 191 >ref|XP_020268541.1| uncharacterized protein LOC109843932 [Asparagus officinalis] Length = 741 Score = 64.7 bits (156), Expect = 8e-09 Identities = 31/61 (50%), Positives = 47/61 (77%) Frame = -2 Query: 186 LQLPFNLSEATKNTTLSKEWINDHLLKVELFRFSIIKKEIKLAASVLQNS*SLQPLKIDP 7 +QLP +L+++ K T + KEW++ HL +VELF+F + KKEIK A ++L N+ SL+ +KIDP Sbjct: 646 VQLPGHLNDSAK-TKVPKEWVHHHLKEVELFQFGVYKKEIKFATNLLHNAKSLELMKIDP 704 Query: 6 R 4 R Sbjct: 705 R 705