BLASTX nr result
ID: Ophiopogon27_contig00026560
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00026560 (529 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265480.1| probable alpha,alpha-trehalose-phosphate syn... 56 6e-06 >ref|XP_020265480.1| probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Asparagus officinalis] gb|ONK70228.1| uncharacterized protein A4U43_C05F31580 [Asparagus officinalis] Length = 826 Score = 56.2 bits (134), Expect = 6e-06 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = -2 Query: 180 MVSQSNANLPSVQSDDLPSYSSNDTSNHVNSDIQTSAREAKRMIMVANFLPLHSRKDEAT 1 MVS+S+A SVQSD++ SS+ +HVNSD KRMIMVANFLPL S KDE T Sbjct: 1 MVSESDAYKLSVQSDNILPNSSDARRSHVNSD-------TKRMIMVANFLPLRSCKDETT 53