BLASTX nr result
ID: Ophiopogon27_contig00026520
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00026520 (568 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266613.1| glycosyltransferase-like At2g41451 [Asparagu... 61 1e-07 >ref|XP_020266613.1| glycosyltransferase-like At2g41451 [Asparagus officinalis] Length = 750 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 4/56 (7%) Frame = +3 Query: 9 LPNSIAGESANTQKIASSKE----SHATNRKILEFSDIFVKALPPMSPPGLDDHHM 164 LP+ +S++T A++KE SHA NRKILEFSDIF KA+PP+SPPGLD H+ Sbjct: 695 LPSMEEKKSSDTAGSANTKEDSTVSHAINRKILEFSDIFEKAVPPISPPGLDSVHL 750