BLASTX nr result
ID: Ophiopogon27_contig00026402
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00026402 (2388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023746560.1| uncharacterized protein LOC111894702 [Lactuc... 56 9e-06 >ref|XP_023746560.1| uncharacterized protein LOC111894702 [Lactuca sativa] ref|XP_023746562.1| uncharacterized protein LOC111894702 [Lactuca sativa] Length = 127 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = +3 Query: 1065 QKRKVVGKPYDPICLLDTKSNYEWNEEKVP-CLSQDASWLNVHVCFE 1202 QKRK G+ YDPICL D +S+ EW EK CL +D SW++VH CF+ Sbjct: 17 QKRKERGETYDPICLSDMESDDEWITEKEDVCLPEDISWMDVHECFK 63