BLASTX nr result
ID: Ophiopogon27_contig00026284
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00026284 (1180 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001238194.1| ribosomal protein S7 [Glycine max] >gi|25562... 306 e-101 ref|YP_740248.1| ribosomal protein S7 [Liriodendron tulipifera] ... 302 e-100 ref|YP_009365458.1| ribosomal protein S7 (plastid) [Illicium flo... 302 e-100 gb|AEX94160.1| ribosomal protein S7 (chloroplast) [Bowiea volubi... 302 e-100 gb|AEX94145.1| ribosomal protein S7 (chloroplast) [Tulbaghia vio... 302 e-100 ref|YP_003434021.1| ribosomal protein S7 [Typha latifolia] >gi|2... 301 1e-99 ref|YP_004769759.1| ribosomal protein S7 [Magnolia kwangsiensis]... 301 1e-99 ref|YP_009402572.1| ribosomal protein S7 (chloroplast) [Pararchi... 301 2e-99 ref|YP_009349320.1| ribosomal protein S7 (chloroplast) [Symploca... 301 2e-99 sp|Q6EMA4.1|RR7_CANWI RecName: Full=30S ribosomal protein S7, ch... 301 2e-99 gb|AHF71952.1| 30S ribosomal protein S7 (chloroplast) [Paeonia s... 301 2e-99 ref|YP_003587510.1| ribosomal protein S7 (chloroplast) [Oncidium... 301 2e-99 ref|WP_064723896.1| 30S ribosomal protein S7 [Paenarthrobacter n... 301 2e-99 ref|YP_009028181.1| ribosomal protein S7 (chloroplast) [Couepia ... 301 2e-99 ref|WP_042854974.1| 30S ribosomal protein S7 [Staphylococcus aur... 301 2e-99 ref|YP_567124.1| ribosomal protein S7 (chloroplast) [Vitis vinif... 301 2e-99 ref|YP_009261910.1| ribosomal protein S7 (chloroplast) [Parastem... 301 3e-99 gb|ABQ14920.1| ribosomal protein S7 (chloroplast) [Rhodoleia cha... 301 3e-99 ref|YP_009109042.1| ribosomal protein S7 (plastid) [Corallorhiza... 301 3e-99 ref|YP_001294399.1| ribosomal protein S7 [Dioscorea elephantipes... 301 3e-99 >ref|NP_001238194.1| ribosomal protein S7 [Glycine max] gb|ACU14175.1| unknown [Glycine max] Length = 173 Score = 306 bits (785), Expect = e-101 Identities = 156/158 (98%), Positives = 158/158 (100%) Frame = -2 Query: 597 FTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETN 418 FTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRA+KKIQQKTETN Sbjct: 16 FTLMSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETN 75 Query: 417 PLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMA 238 PLSVLRQAIRGVTPDIAVKARRVGGSTHQVP+EIGSTQGKALAIRWLLGASRKRPGRNMA Sbjct: 76 PLSVLRQAIRGVTPDIAVKARRVGGSTHQVPVEIGSTQGKALAIRWLLGASRKRPGRNMA 135 Query: 237 FKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 FKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 136 FKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 173 >ref|YP_740248.1| ribosomal protein S7 [Liriodendron tulipifera] ref|YP_740261.1| ribosomal protein S7 [Liriodendron tulipifera] ref|YP_740611.1| ribosomal protein S7 [Platanus occidentalis] ref|YP_740624.1| ribosomal protein S7 [Platanus occidentalis] ref|YP_784433.1| ribosomal protein S7 [Drimys granadensis] ref|YP_784446.1| ribosomal protein S7 [Drimys granadensis] ref|YP_001294316.1| ribosomal protein S7 [Illicium oligandrum] ref|YP_001294330.1| ribosomal protein S7 [Illicium oligandrum] ref|YP_001294230.1| ribosomal protein S7 [Buxus microphylla] ref|YP_001294244.1| ribosomal protein S7 [Buxus microphylla] ref|YP_007476093.1| ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] ref|YP_007476107.1| ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] ref|YP_008963738.1| ribosomal protein S7 (chloroplast) [Liquidambar formosana] ref|YP_008963751.1| ribosomal protein S7 (chloroplast) [Liquidambar formosana] ref|YP_009027932.1| ribosomal protein S7 (chloroplast) (chloroplast) [Hirtella racemosa] ref|YP_009027945.1| ribosomal protein S7 (chloroplast) (chloroplast) [Hirtella racemosa] ref|YP_009028015.1| ribosomal protein S7 (chloroplast) (chloroplast) [Chrysobalanus icaco] ref|YP_009028028.1| ribosomal protein S7 (chloroplast) (chloroplast) [Chrysobalanus icaco] ref|YP_009028264.1| ribosomal protein S7 (chloroplast) (chloroplast) [Licania alba] ref|YP_009028277.1| ribosomal protein S7 (chloroplast) (chloroplast) [Licania alba] ref|YP_009028347.1| ribosomal protein S7 (chloroplast) (chloroplast) [Licania sprucei] ref|YP_009028360.1| ribosomal protein S7 (chloroplast) (chloroplast) [Licania sprucei] ref|YP_009045611.1| ribosomal protein S7 (chloroplast) [Cypripedium macranthos] ref|YP_009045624.1| ribosomal protein S7 (chloroplast) [Cypripedium macranthos] ref|YP_009028430.1| ribosomal protein S7 (chloroplast) [Hirtella physophora] ref|YP_009028443.1| ribosomal protein S7 (chloroplast) [Hirtella physophora] ref|YP_009092350.1| ribosomal protein S7 (chloroplast) [Macadamia integrifolia] ref|YP_009092364.1| ribosomal protein S7 (chloroplast) [Macadamia integrifolia] ref|YP_009114493.1| ribosomal protein S7 (chloroplast) [Paeonia obovata] ref|YP_009114505.1| ribosomal protein S7 (chloroplast) [Paeonia obovata] ref|YP_009183244.1| ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] ref|YP_009183256.1| ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] ref|YP_009228810.1| ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] ref|YP_009228822.1| ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] ref|YP_009231294.1| ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] ref|YP_009231307.1| ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] ref|YP_009234770.1| ribosomal protein S7 (chloroplast) [Sabia yunnanensis] ref|YP_009234783.1| ribosomal protein S7 (chloroplast) [Sabia yunnanensis] ref|YP_009236417.1| ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] ref|YP_009236405.1| ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] ref|YP_009262993.1| ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] ref|YP_009263006.1| ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] ref|YP_009263159.1| ribosomal protein S7 (chloroplast) [Atuna racemosa] ref|YP_009263172.1| ribosomal protein S7 (chloroplast) [Atuna racemosa] ref|YP_009263906.1| ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] ref|YP_009263919.1| ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] ref|YP_009263989.1| ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] ref|YP_009264002.1| ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] ref|YP_009264072.1| ribosomal protein S7 (chloroplast) [Dactyladenia floretii] ref|YP_009264085.1| ribosomal protein S7 (chloroplast) [Dactyladenia floretii] ref|YP_009264155.1| ribosomal protein S7 (chloroplast) [Exellodendron barbatum] ref|YP_009264168.1| ribosomal protein S7 (chloroplast) [Exellodendron barbatum] ref|YP_009264238.1| ribosomal protein S7 (chloroplast) [Gaulettia elata] ref|YP_009264251.1| ribosomal protein S7 (chloroplast) [Gaulettia elata] ref|YP_009264321.1| ribosomal protein S7 (chloroplast) [Grangeria borbonica] ref|YP_009264334.1| ribosomal protein S7 (chloroplast) [Grangeria borbonica] ref|YP_009264404.1| ribosomal protein S7 (chloroplast) [Hirtella macrosepala] ref|YP_009264417.1| ribosomal protein S7 (chloroplast) [Hirtella macrosepala] ref|YP_009264487.1| ribosomal protein S7 (chloroplast) [Hirtella suffulta] ref|YP_009264500.1| ribosomal protein S7 (chloroplast) [Hirtella suffulta] ref|YP_009264570.1| ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] ref|YP_009264583.1| ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] ref|YP_009264653.1| ribosomal protein S7 (chloroplast) [Hunga gerontogea] ref|YP_009264666.1| ribosomal protein S7 (chloroplast) [Hunga gerontogea] ref|YP_009264817.1| ribosomal protein S7 (chloroplast) [Licania canescens] ref|YP_009264830.1| ribosomal protein S7 (chloroplast) [Licania canescens] ref|YP_009264900.1| ribosomal protein S7 (chloroplast) [Licania glabriflora] ref|YP_009264913.1| ribosomal protein S7 (chloroplast) [Licania glabriflora] ref|YP_009264983.1| ribosomal protein S7 (chloroplast) [Licania macrophylla] ref|YP_009264996.1| ribosomal protein S7 (chloroplast) [Licania macrophylla] ref|YP_009265066.1| ribosomal protein S7 (chloroplast) [Licania majuscula] ref|YP_009265079.1| ribosomal protein S7 (chloroplast) [Licania majuscula] ref|YP_009265149.1| ribosomal protein S7 (chloroplast) [Licania membranacea] ref|YP_009265162.1| ribosomal protein S7 (chloroplast) [Licania membranacea] ref|YP_009265232.1| ribosomal protein S7 (chloroplast) [Licania michauxii] ref|YP_009265245.1| ribosomal protein S7 (chloroplast) [Licania michauxii] ref|YP_009265315.1| ribosomal protein S7 (chloroplast) [Licania micrantha] ref|YP_009265328.1| ribosomal protein S7 (chloroplast) [Licania micrantha] ref|YP_009265398.1| ribosomal protein S7 (chloroplast) [Licania minutiflora] ref|YP_009265411.1| ribosomal protein S7 (chloroplast) [Licania minutiflora] ref|YP_009265481.1| ribosomal protein S7 (chloroplast) [Licania ovalifolia] ref|YP_009265494.1| ribosomal protein S7 (chloroplast) [Licania ovalifolia] ref|YP_009265564.1| ribosomal protein S7 (chloroplast) [Licania tomentosa] ref|YP_009265577.1| ribosomal protein S7 (chloroplast) [Licania tomentosa] ref|YP_009265647.1| ribosomal protein S7 (chloroplast) [Magnistipula butayei] ref|YP_009265660.1| ribosomal protein S7 (chloroplast) [Magnistipula butayei] ref|YP_009265730.1| ribosomal protein S7 (chloroplast) [Maranthes gabunensis] ref|YP_009265743.1| ribosomal protein S7 (chloroplast) [Maranthes gabunensis] ref|YP_009265813.1| ribosomal protein S7 (chloroplast) [Maranthes glabra] ref|YP_009265826.1| ribosomal protein S7 (chloroplast) [Maranthes glabra] ref|YP_009265896.1| ribosomal protein S7 (chloroplast) [Maranthes kerstingii] ref|YP_009265909.1| ribosomal protein S7 (chloroplast) [Maranthes kerstingii] ref|YP_009262570.1| ribosomal protein S7 (chloroplast) [Acioa guianensis] ref|YP_009262583.1| ribosomal protein S7 (chloroplast) [Acioa guianensis] ref|YP_009333070.1| 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] ref|YP_009333082.1| 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] ref|YP_009334450.1| ribosomal protein S7 (chloroplast) [Albuca kirkii] ref|YP_009334463.1| ribosomal protein S7 (chloroplast) [Albuca kirkii] ref|YP_009334536.1| ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] ref|YP_009334549.1| ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] ref|YP_009334621.1| ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] ref|YP_009334634.1| ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] ref|YP_009334705.1| ribosomal protein S7 (chloroplast) [Camassia scilloides] ref|YP_009334718.1| ribosomal protein S7 (chloroplast) [Camassia scilloides] ref|YP_009334789.1| ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] ref|YP_009334802.1| ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] ref|YP_009334873.1| ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] ref|YP_009334886.1| ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] ref|YP_009334957.1| ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] ref|YP_009334970.1| ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] ref|YP_009335040.1| ribosomal protein S7 (chloroplast) [Hesperocallis undulata] ref|YP_009335053.1| ribosomal protein S7 (chloroplast) [Hesperocallis undulata] ref|YP_009335125.1| ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] ref|YP_009335138.1| ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] ref|YP_009335208.1| ribosomal protein S7 (chloroplast) [Hosta ventricosa] ref|YP_009335221.1| ribosomal protein S7 (chloroplast) [Hosta ventricosa] ref|YP_009335378.1| ribosomal protein S7 (chloroplast) [Nolina atopocarpa] ref|YP_009335391.1| ribosomal protein S7 (chloroplast) [Nolina atopocarpa] ref|YP_009335464.1| ribosomal protein S7 (chloroplast) [Oziroe biflora] ref|YP_009335477.1| ribosomal protein S7 (chloroplast) [Oziroe biflora] ref|YP_009335549.1| ribosomal protein S7 (chloroplast) [Schoenolirion croceum] ref|YP_009335562.1| ribosomal protein S7 (chloroplast) [Schoenolirion croceum] ref|YP_009341932.1| ribosomal protein S7 (chloroplast) [Aletris spicata] ref|YP_009341919.1| ribosomal protein S7 (chloroplast) [Aletris spicata] ref|YP_009342016.1| ribosomal protein S7 (chloroplast) [Aletris fauriei] ref|YP_009342003.1| ribosomal protein S7 (chloroplast) [Aletris fauriei] ref|YP_009366980.1| ribosomal protein S7 (plastid) [Illicium anisatum] ref|YP_009365801.1| ribosomal protein S7 (plastid) [Illicium verum] ref|YP_009366654.1| ribosomal protein S7 (plastid) [Illicium henryi] ref|YP_009414689.1| 30S ribosomal protein S7 (chloroplast) [Paeonia ludlowii] ref|YP_009414704.1| 30S ribosomal protein S7 (chloroplast) [Paeonia ludlowii] ref|YP_009420117.1| 30S ribosomal protein S7 (chloroplast) [Paeonia delavayi] ref|YP_009420132.1| 30S ribosomal protein S7 (chloroplast) [Paeonia delavayi] ref|YP_009431092.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] ref|YP_009431105.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] ref|YP_009431264.1| ribosomal protein S7 (chloroplast) [Maianthemum bicolor] ref|YP_009431277.1| ribosomal protein S7 (chloroplast) [Maianthemum bicolor] ref|YP_009432348.1| ribosomal protein S7 (chloroplast) [Polygonatum stenophyllum] ref|YP_009432361.1| ribosomal protein S7 (chloroplast) [Polygonatum stenophyllum] ref|YP_009432434.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea preissii] ref|YP_009432447.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea preissii] ref|YP_009432519.1| ribosomal protein S7 (chloroplast) [Barnardia japonica] ref|YP_009432532.1| ribosomal protein S7 (chloroplast) [Barnardia japonica] ref|YP_009432699.1| ribosomal protein S7 (chloroplast) [Hosta minor] ref|YP_009432686.1| ribosomal protein S7 (chloroplast) [Hosta minor] ref|YP_009432771.1| ribosomal protein S7 (chloroplast) [Milla biflora] ref|YP_009432784.1| ribosomal protein S7 (chloroplast) [Milla biflora] ref|YP_009434724.1| 30S ribosomal protein S7 (chloroplast) [Sinowilsonia henryi] ref|YP_009434737.1| 30S ribosomal protein S7 (chloroplast) [Sinowilsonia henryi] ref|YP_009445478.1| ribosomal protein S7 (plastid) [Macadamia ternifolia] ref|YP_009445492.1| ribosomal protein S7 (plastid) [Macadamia ternifolia] ref|YP_009458357.1| ribosomal protein S7 (chloroplast) [Paeonia ostii] ref|YP_009458345.1| ribosomal protein S7 (chloroplast) [Paeonia ostii] ref|YP_009471675.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] ref|YP_009471688.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] sp|Q67IB6.1|RR7_MAIRA RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q67IE0.1|RR7_SISMO RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q6EM68.1|RR7_PLAOC RecName: Full=30S ribosomal protein S7, chloroplastic sp|P69663.1|RR7_CERJA RecName: Full=30S ribosomal protein S7, chloroplastic sp|P69664.1|RR7_DRIWI RecName: Full=30S ribosomal protein S7, chloroplastic sp|P69665.1|RR7_ILLPA RecName: Full=30S ribosomal protein S7, chloroplastic sp|P69666.1|RR7_LIRTU RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q67IB0.1|RR7_LEOCS RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q67IE3.1|RR7_PHOTN RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q06GT7.1|RR7_DRIGR RecName: Full=30S ribosomal protein S7, chloroplastic sp|A6MM82.1|RR7_BUXMI RecName: Full=30S ribosomal protein S7, chloroplastic sp|A6MMZ0.1|RR7_ILLOL RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAG26107.1| ribosomal protein S7 (chloroplast) [Cercidiphyllum japonicum] gb|AAG26113.1| ribosomal protein S7 (chloroplast) [Drimys winteri] gb|AAG26119.1| ribosomal protein S7 (chloroplast) [Illicium parviflorum] gb|AAG26125.1| ribosomal protein S7 (chloroplast) [Liriodendron tulipifera] gb|AAQ14201.1| ribosomal protein S7 (chloroplast) [Austrobaileya scandens] gb|AAQ64573.1| ribosomal protein S7 (chloroplast) [Platanus occidentalis] gb|AAN31991.1| ribosomal protein S7 (chloroplast) [Dasypogon hookeri] gb|AAN32022.1| ribosomal protein S7 (chloroplast) [Alania cunninghamii] gb|AAN32025.1| ribosomal protein S7 (chloroplast) [Asphodelus albus] gb|AAN32028.1| ribosomal protein S7 (chloroplast) [Astelia alpina] gb|AAN32040.1| ribosomal protein S7 (chloroplast) [Cyanastrum cordifolium] gb|AAN32045.1| ribosomal protein S7 (chloroplast) [Hemerocallis littorea] gb|AAN32060.1| ribosomal protein S7 (chloroplast) [Phormium tenax] gb|AAN32063.1| ribosomal protein S7 (chloroplast) [Sisyrinchium montanum] gb|AAN32066.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea resinosa] gb|AAN32075.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] gb|AAN32087.1| ribosomal protein S7 (chloroplast) [Maianthemum racemosum] gb|AAN32090.1| ribosomal protein S7 (chloroplast) [Muilla maritima] gb|AAN32093.1| ribosomal protein S7 (chloroplast) [Leopoldia comosa] gb|AAN32096.1| ribosomal protein S7 (chloroplast) [Narcissus elegans] gb|ABH88343.1| ribosomal protein S7 (chloroplast) [Drimys granadensis] gb|ABH88358.1| ribosomal protein S7 (chloroplast) [Drimys granadensis] gb|ABI32555.1| ribosomal protein S7 (chloroplast) [Liriodendron tulipifera] gb|ABI32569.1| ribosomal protein S7 (chloroplast) [Liriodendron tulipifera] gb|ABI49825.1| ribosomal protein S7 (chloroplast) [Platanus occidentalis] gb|ABI49838.1| ribosomal protein S7 (chloroplast) [Platanus occidentalis] gb|ABQ14818.1| ribosomal protein S7 (chloroplast) [Cercidiphyllum japonicum] gb|ABQ14826.1| ribosomal protein S7 (chloroplast) [Daphniphyllum sp. 205-82] gb|ABQ14834.1| ribosomal protein S7 (chloroplast) [Hamamelis japonica] gb|ABQ14886.1| ribosomal protein S7 (chloroplast) [Paeonia brownii] gb|ABQ45294.1| ribosomal protein S7 (chloroplast) [Buxus microphylla] gb|ABQ45310.1| ribosomal protein S7 (chloroplast) [Buxus microphylla] gb|ABQ52564.1| ribosomal protein S7 (chloroplast) [Illicium oligandrum] gb|ABQ52580.1| ribosomal protein S7 (chloroplast) [Illicium oligandrum] gb|ADD29908.1| ribosomal protein S7 (chloroplast) [Liquidambar styraciflua] gb|AEK71760.1| ribosomal protein S7 (plastid) [Liquidambar styraciflua] gb|AEK71822.1| ribosomal protein S7 (plastid) [Hedyosmum mexicanum] gb|AEK78132.1| ribosomal protein S7 (plastid) [Tasmannia lanceolata] gb|AEX94136.1| ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] gb|AEX94137.1| ribosomal protein S7 (chloroplast) [Camassia scilloides] gb|AEX94139.1| ribosomal protein S7 (chloroplast) [Hosta ventricosa] gb|AEX94146.1| ribosomal protein S7 (chloroplast) [Amaryllis belladonna] gb|AEX94147.1| ribosomal protein S7 (chloroplast) [Crinum asiaticum] gb|AEX94149.1| ribosomal protein S7 (chloroplast) [Scadoxus cinnabarinus] gb|AEX94150.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] gb|AEX94155.1| ribosomal protein S7 (chloroplast) [Asphodeline damascena] gb|AEX94157.1| ribosomal protein S7 (chloroplast) [Kniphofia linearifolia] gb|AEX94159.1| ribosomal protein S7 (chloroplast) [Phormium tenax] gb|AEX94161.1| ribosomal protein S7 (chloroplast) [Drimia altissima] gb|AEX94162.1| ribosomal protein S7 (chloroplast) [Ledebouria cordifolia] gb|AEX94163.1| ribosomal protein S7 (chloroplast) [Ornithogalum tenuifolium] gb|AEX94164.1| ribosomal protein S7 (chloroplast) [Oziroe biflora] gb|AEX94168.1| ribosomal protein S7 (chloroplast) [Beaucarnea hookeri] gb|AEX94169.1| ribosomal protein S7 (chloroplast) [Dasylirion wheeleri] gb|AEX94170.1| ribosomal protein S7 (chloroplast) [Eriospermum cervicorne] gb|AEX94171.1| ribosomal protein S7 (chloroplast) [Liriope spicata] gb|AEX94172.1| ribosomal protein S7 (chloroplast) [Ophiopogon japonicus] gb|AEX94173.1| ribosomal protein S7 (chloroplast) [Ruscus aculeatus] gb|AEX94174.1| ribosomal protein S7 (chloroplast) [Sansevieria trifasciata] gb|AEX94175.1| ribosomal protein S7 (chloroplast) [Maianthemum stellatum] gb|AEX94176.1| ribosomal protein S7 (chloroplast) [Androstephium coeruleum] gb|AEX94181.1| ribosomal protein S7 (chloroplast) [Triteleia hyacinthina] gb|AEX94182.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea preissii] gb|AFG25678.1| ribosomal protein S7 (plastid) [Albuca kirkii] gb|AFG25688.1| ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] gb|AFG25694.1| ribosomal protein S7, partial (plastid) [Hesperaloe parviflora] gb|AFG25695.1| ribosomal protein S7, partial (plastid) [Hosta ventricosa] gb|AFG25702.1| ribosomal protein S7, partial (plastid) [Neoastelia spectabilis] gb|AFG25704.1| ribosomal protein S7, partial (plastid) [Nolina atopocarpa] gb|AFG25706.1| ribosomal protein S7, partial (plastid) [Phormium tenax] gb|AGE93157.1| ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] gb|AGE93173.1| ribosomal protein S7 (plastid) [Dasypogon bromeliifolius] gb|AGL13477.1| ribosomal protein S7 (chloroplast) [Liquidambar formosana] gb|AGL13490.1| ribosomal protein S7 (chloroplast) [Liquidambar formosana] gb|AHB38205.1| ribosomal protein S7 (chloroplast) [Macadamia integrifolia] gb|AHB38221.1| ribosomal protein S7 (chloroplast) [Macadamia integrifolia] gb|AHI16794.1| ribosomal protein S7 (chloroplast) (chloroplast) [Cypripedium macranthos] gb|AHI16807.1| ribosomal protein S7 (chloroplast) (chloroplast) [Cypripedium macranthos] gb|AHV83399.1| ribosomal protein S7 (chloroplast) [Paeonia obovata] gb|AHV83409.1| ribosomal protein S7 (chloroplast) [Paeonia obovata] gb|AHX80652.1| ribosomal protein S7 (chloroplast) [Hirtella racemosa] gb|AHX80653.1| ribosomal protein S7 (chloroplast) [Hirtella racemosa] gb|AHX80735.1| ribosomal protein S7 (chloroplast) [Chrysobalanus icaco] gb|AHX80736.1| ribosomal protein S7 (chloroplast) [Chrysobalanus icaco] gb|AHX80984.1| ribosomal protein S7 (chloroplast) [Licania alba] gb|AHX80985.1| ribosomal protein S7 (chloroplast) [Licania alba] gb|AHX81067.1| ribosomal protein S7 (chloroplast) [Licania sprucei] gb|AHX81068.1| ribosomal protein S7 (chloroplast) [Licania sprucei] gb|AHX81150.1| ribosomal protein S7 (chloroplast) [Hirtella physophora] gb|AHX81151.1| ribosomal protein S7 (chloroplast) [Hirtella physophora] gb|AKR80939.1| ribosomal protein S7 (plastid) [Lophiola aurea] gb|ALM87750.1| ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] gb|ALM87751.1| ribosomal protein S7 (chloroplast) [Polygonatum verticillatum] gb|ALO71310.1| ribosomal protein S7 (chloroplast) [Ampelopsis glandulosa var. brevipedunculata] gb|ALO71324.1| ribosomal protein S7 (chloroplast) [Ampelopsis glandulosa var. brevipedunculata] gb|ALS19972.1| ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] gb|ALS19973.1| ribosomal protein S7 (chloroplast) [Metanarthecium luteoviride] gb|ALS20235.1| 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] gb|ALS20236.1| 30S ribosomal protein S7 (chloroplast) [Paeonia veitchii] gb|ALV25527.1| ribosomal protein S7 (chloroplast) [Aletris spicata] gb|ALV25528.1| ribosomal protein S7 (chloroplast) [Aletris spicata] gb|ALV25611.1| ribosomal protein S7 (chloroplast) [Aletris fauriei] gb|ALV25612.1| ribosomal protein S7 (chloroplast) [Aletris fauriei] gb|ALV89972.1| ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] gb|ALV89985.1| ribosomal protein S7 (chloroplast) [Tetrastigma hemsleyanum] gb|AMD08487.1| ribosomal protein S7 (chloroplast) [Sabia yunnanensis] gb|AMD08500.1| ribosomal protein S7 (chloroplast) [Sabia yunnanensis] gb|AMF84106.1| ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] gb|AMF84107.1| ribosomal protein S7 (chloroplast) [Polygonatum sibiricum] gb|ANI87215.1| ribosomal protein S7 (chloroplast) [Acioa guianensis] gb|ANI87216.1| ribosomal protein S7 (chloroplast) [Acioa guianensis] gb|ANJ17111.1| ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] gb|ANJ17112.1| ribosomal protein S7 (chloroplast) [Afrolicania elaeosperma] gb|ANJ17276.1| ribosomal protein S7 (chloroplast) [Atuna racemosa] gb|ANJ17277.1| ribosomal protein S7 (chloroplast) [Atuna racemosa] gb|ANJ18107.1| ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] gb|ANJ18108.1| ribosomal protein S7 (chloroplast) [Dactyladenia bellayana] gb|ANJ18190.1| ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] gb|ANJ18191.1| ribosomal protein S7 (chloroplast) [Dactyladenia buchneri] gb|ANJ18273.1| ribosomal protein S7 (chloroplast) [Dactyladenia floretii] gb|ANJ18274.1| ribosomal protein S7 (chloroplast) [Dactyladenia floretii] gb|ANJ18356.1| ribosomal protein S7 (chloroplast) [Exellodendron barbatum] gb|ANJ18357.1| ribosomal protein S7 (chloroplast) [Exellodendron barbatum] gb|ANJ18439.1| ribosomal protein S7 (chloroplast) [Gaulettia elata] gb|ANJ18440.1| ribosomal protein S7 (chloroplast) [Gaulettia elata] gb|ANJ18522.1| ribosomal protein S7 (chloroplast) [Grangeria borbonica] gb|ANJ18523.1| ribosomal protein S7 (chloroplast) [Grangeria borbonica] gb|ANJ18605.1| ribosomal protein S7 (chloroplast) [Hirtella macrosepala] gb|ANJ18606.1| ribosomal protein S7 (chloroplast) [Hirtella macrosepala] gb|ANJ18688.1| ribosomal protein S7 (chloroplast) [Hirtella racemosa] gb|ANJ18689.1| ribosomal protein S7 (chloroplast) [Hirtella racemosa] gb|ANJ18771.1| ribosomal protein S7 (chloroplast) [Hirtella suffulta] gb|ANJ18772.1| ribosomal protein S7 (chloroplast) [Hirtella suffulta] gb|ANJ18854.1| ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] gb|ANJ18855.1| ribosomal protein S7 (chloroplast) [Hirtella zanzibarica] gb|ANJ18937.1| ribosomal protein S7 (chloroplast) [Hunga gerontogea] gb|ANJ18938.1| ribosomal protein S7 (chloroplast) [Hunga gerontogea] gb|ANJ19101.1| ribosomal protein S7 (chloroplast) [Licania canescens] gb|ANJ19102.1| ribosomal protein S7 (chloroplast) [Licania canescens] gb|ANJ19184.1| ribosomal protein S7 (chloroplast) [Licania glabriflora] gb|ANJ19185.1| ribosomal protein S7 (chloroplast) [Licania glabriflora] gb|ANJ19267.1| ribosomal protein S7 (chloroplast) [Licania macrophylla] gb|ANJ19268.1| ribosomal protein S7 (chloroplast) [Licania macrophylla] gb|ANJ19350.1| ribosomal protein S7 (chloroplast) [Licania majuscula] gb|ANJ19351.1| ribosomal protein S7 (chloroplast) [Licania majuscula] gb|ANJ19433.1| ribosomal protein S7 (chloroplast) [Licania membranacea] gb|ANJ19434.1| ribosomal protein S7 (chloroplast) [Licania membranacea] gb|ANJ19516.1| ribosomal protein S7 (chloroplast) [Licania michauxii] gb|ANJ19517.1| ribosomal protein S7 (chloroplast) [Licania michauxii] gb|ANJ19618.1| ribosomal protein S7 (chloroplast) [Licania micrantha] gb|ANJ19633.1| ribosomal protein S7 (chloroplast) [Licania micrantha] gb|ANJ19701.1| ribosomal protein S7 (chloroplast) [Licania minutiflora] gb|ANJ19716.1| ribosomal protein S7 (chloroplast) [Licania minutiflora] gb|ANJ19784.1| ribosomal protein S7 (chloroplast) [Licania ovalifolia] gb|ANJ19799.1| ribosomal protein S7 (chloroplast) [Licania ovalifolia] gb|ANJ19867.1| ribosomal protein S7 (chloroplast) [Licania tomentosa] gb|ANJ19882.1| ribosomal protein S7 (chloroplast) [Licania tomentosa] gb|ANJ19950.1| ribosomal protein S7 (chloroplast) [Magnistipula butayei] gb|ANJ19965.1| ribosomal protein S7 (chloroplast) [Magnistipula butayei] gb|ANJ20014.1| ribosomal protein S7 (chloroplast) [Maranthes gabunensis] gb|ANJ20015.1| ribosomal protein S7 (chloroplast) [Maranthes gabunensis] gb|ANJ20097.1| ribosomal protein S7 (chloroplast) [Maranthes glabra] gb|ANJ20098.1| ribosomal protein S7 (chloroplast) [Maranthes glabra] gb|ANJ20180.1| ribosomal protein S7 (chloroplast) [Maranthes kerstingii] gb|ANJ20181.1| ribosomal protein S7 (chloroplast) [Maranthes kerstingii] gb|APO11260.1| ribosomal protein S7 (chloroplast) [Albuca kirkii] gb|APO11273.1| ribosomal protein S7 (chloroplast) [Albuca kirkii] gb|APO11346.1| ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] gb|APO11359.1| ribosomal protein S7 (chloroplast) [Anemarrhena asphodeloides] gb|APO11430.1| ribosomal protein S7 (chloroplast) [Behnia reticulata] gb|APO11443.1| ribosomal protein S7 (chloroplast) [Behnia reticulata] gb|APO11514.1| ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] gb|APO11527.1| ribosomal protein S7 (chloroplast) [Beschorneria septentrionalis] gb|APO11598.1| ribosomal protein S7 (chloroplast) [Camassia scilloides] gb|APO11611.1| ribosomal protein S7 (chloroplast) [Camassia scilloides] gb|APO11682.1| ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] gb|APO11695.1| ribosomal protein S7 (chloroplast) [Chlorogalum pomeridianum] gb|APO11931.1| ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] gb|APO11944.1| ribosomal protein S7 (chloroplast) [Hesperaloe campanulata] gb|APO12015.1| ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] gb|APO12028.1| ribosomal protein S7 (chloroplast) [Hesperaloe parviflora] gb|APO12098.1| ribosomal protein S7 (chloroplast) [Hesperocallis undulata] gb|APO12111.1| ribosomal protein S7 (chloroplast) [Hesperocallis undulata] gb|APO12183.1| ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] gb|APO12196.1| ribosomal protein S7 (chloroplast) [Hesperoyucca whipplei] gb|APO12266.1| ribosomal protein S7 (chloroplast) [Hosta ventricosa] gb|APO12279.1| ribosomal protein S7 (chloroplast) [Hosta ventricosa] gb|APO12436.1| ribosomal protein S7 (chloroplast) [Nolina atopocarpa] gb|APO12449.1| ribosomal protein S7 (chloroplast) [Nolina atopocarpa] gb|APO12522.1| ribosomal protein S7 (chloroplast) [Oziroe biflora] gb|APO12535.1| ribosomal protein S7 (chloroplast) [Oziroe biflora] gb|APO12693.1| ribosomal protein S7 (chloroplast) [Schoenolirion croceum] gb|APO12706.1| ribosomal protein S7 (chloroplast) [Schoenolirion croceum] gb|ARJ61286.1| ribosomal protein S7 (plastid) [Illicium verum] gb|ARJ62478.1| ribosomal protein S7 (plastid) [Illicium henryi] gb|ARJ63232.1| ribosomal protein S7 (plastid) [Illicium anisatum] gb|ASO75455.1| 30S ribosomal protein S7 (chloroplast) [Paeonia delavayi] gb|ASO75456.1| 30S ribosomal protein S7 (chloroplast) [Paeonia delavayi] gb|ASO75541.1| 30S ribosomal protein S7 (chloroplast) [Paeonia ludlowii] gb|ASO75542.1| 30S ribosomal protein S7 (chloroplast) [Paeonia ludlowii] gb|ASW26527.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] gb|ASW26542.1| ribosomal protein S7 (chloroplast) [Aphyllanthes monspeliensis] gb|ASW26700.1| ribosomal protein S7 (chloroplast) [Maianthemum bicolor] gb|ASW26714.1| ribosomal protein S7 (chloroplast) [Maianthemum bicolor] gb|ATB18603.1| ribosomal protein S7 (chloroplast) [Polygonatum stenophyllum] gb|ATB18617.1| ribosomal protein S7 (chloroplast) [Polygonatum stenophyllum] gb|ATB18689.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea preissii] gb|ATB18703.1| ribosomal protein S7 (chloroplast) [Xanthorrhoea preissii] gb|ATB18774.1| ribosomal protein S7 (chloroplast) [Barnardia japonica] gb|ATB18788.1| ribosomal protein S7 (chloroplast) [Barnardia japonica] gb|ATB18891.1| ribosomal protein S7 (chloroplast) [Hosta minor] gb|ATB18939.1| ribosomal protein S7 (chloroplast) [Hosta minor] gb|ATB19026.1| ribosomal protein S7 (chloroplast) [Milla biflora] gb|ATB19040.1| ribosomal protein S7 (chloroplast) [Milla biflora] gb|ATG24524.1| 30S ribosomal protein S7 (chloroplast) [Sinowilsonia henryi] gb|ATG24537.1| 30S ribosomal protein S7 (chloroplast) [Sinowilsonia henryi] gb|ATV96213.1| ribosomal protein S7 (plastid) [Macadamia ternifolia] gb|ATV96227.1| ribosomal protein S7 (plastid) [Macadamia ternifolia] gb|AUR26714.1| ribosomal protein S7 (chloroplast) [Paeonia ostii] gb|AUR26727.1| ribosomal protein S7 (chloroplast) [Paeonia ostii] gb|AVI15343.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] gb|AVI15356.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] gb|AVI15429.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] gb|AVI15442.1| ribosomal protein S7 (chloroplast) [Parrotia subaequalis] Length = 155 Score = 302 bits (774), Expect = e-100 Identities = 155/155 (100%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009365458.1| ribosomal protein S7 (plastid) [Illicium floridanum] gb|ARJ60954.1| ribosomal protein S7 (plastid) [Illicium floridanum] Length = 155 Score = 302 bits (773), Expect = e-100 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRG+TPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGITPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AEX94160.1| ribosomal protein S7 (chloroplast) [Bowiea volubilis] Length = 155 Score = 302 bits (773), Expect = e-100 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSEL+DAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELIDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|AEX94145.1| ribosomal protein S7 (chloroplast) [Tulbaghia violacea] Length = 155 Score = 302 bits (773), Expect = e-100 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARR+GGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRIGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_003434021.1| ribosomal protein S7 [Typha latifolia] ref|YP_003434034.1| ribosomal protein S7 [Typha latifolia] ref|YP_004563913.1| ribosomal protein S7 [Nelumbo lutea] ref|YP_004563926.1| ribosomal protein S7 [Nelumbo lutea] ref|YP_009093995.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] ref|YP_009094008.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] sp|Q67II8.1|RR7_TYPAN RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q6EM84.1|RR7_NELLU RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAQ64557.1| ribosomal protein S7 (chloroplast) [Nelumbo lutea] gb|AAN32012.1| ribosomal protein S7 (chloroplast) [Talbotia elegans] gb|AAN32015.1| ribosomal protein S7 (chloroplast) [Typha angustifolia] gb|AAS65724.1| ribosomal protein S7 (chloroplast) [Sparganium eurycarpum] gb|AAZ03887.1| ribosomal protein S7, partial (chloroplast) [Typha latifolia] gb|ACN49370.1| ribosomal protein S7 (chloroplast) [Nelumbo lutea] gb|ACN49384.1| ribosomal protein S7 (chloroplast) [Nelumbo lutea] gb|ACN49455.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|ACN49468.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|ADA63745.1| ribosomal protein S7 (chloroplast) [Typha latifolia] gb|ADA63759.1| ribosomal protein S7 (chloroplast) [Typha latifolia] gb|ADD29896.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|ADZ93754.1| ribosomal protein S7 (chloroplast) [Brocchinia micrantha] gb|ADZ93770.1| ribosomal protein S7 (chloroplast) [Stegolepis sp. Kubitki et al. 97-30] gb|AEK71648.1| ribosomal protein S7 (plastid) [Nelumbo nucifera] gb|AEX01252.1| ribosomal protein S7 (plastid) [Brocchinia micrantha] gb|AFG25682.1| ribosomal protein S7, partial (plastid) [Brocchinia micrantha] gb|AFG25700.1| ribosomal protein S7 (plastid) [Mayaca fluviatilis] gb|AFG25708.1| ribosomal protein S7, partial (plastid) [Potarophytum riparium] gb|AFG25712.1| ribosomal protein S7, partial (plastid) [Sparganium eurycarpum] gb|AFH01494.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AFH01509.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AFH01580.1| ribosomal protein S7 (chloroplast) [Nelumbo lutea] gb|AFH01586.1| ribosomal protein S7 (chloroplast) [Nelumbo lutea] gb|AGO98569.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AGO98582.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AIY33869.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AIY33882.1| ribosomal protein S7 (chloroplast) [Nelumbo nucifera] gb|AKR80856.1| ribosomal protein S7 (plastid) [Xerophyta retinervis] Length = 155 Score = 301 bits (772), Expect = 1e-99 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRI+KHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRIMKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_004769759.1| ribosomal protein S7 [Magnolia kwangsiensis] ref|YP_004769772.1| ribosomal protein S7 [Magnolia kwangsiensis] ref|YP_006576159.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] ref|YP_006576174.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] ref|YP_007474414.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis] ref|YP_007474426.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis] ref|YP_007474497.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] ref|YP_007474510.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] ref|YP_007474581.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] ref|YP_007474594.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] ref|YP_008993222.1| ribosomal protein S7 (chloroplast) [Magnolia cathcartii] ref|YP_008993235.1| ribosomal protein S7 (chloroplast) [Magnolia cathcartii] ref|YP_008993308.1| ribosomal protein S7 (chloroplast) [Magnolia macrophylla var. dealbata] ref|YP_008993321.1| ribosomal protein S7 (chloroplast) [Magnolia macrophylla var. dealbata] ref|YP_008993394.1| ribosomal protein S7 (chloroplast) [Magnolia pyramidata] ref|YP_008993407.1| ribosomal protein S7 (chloroplast) [Magnolia pyramidata] ref|YP_008993480.1| ribosomal protein S7 (chloroplast) [Magnolia kobus] ref|YP_008993493.1| ribosomal protein S7 (chloroplast) [Magnolia kobus] ref|YP_008993566.1| ribosomal protein S7 (chloroplast) [Magnolia liliifera] ref|YP_008993579.1| ribosomal protein S7 (chloroplast) [Magnolia liliifera] ref|YP_008993652.1| ribosomal protein S7 (chloroplast) [Magnolia odora] ref|YP_008993665.1| ribosomal protein S7 (chloroplast) [Magnolia odora] ref|YP_008993824.1| ribosomal protein S7 (chloroplast) [Magnolia sinica] ref|YP_008993837.1| ribosomal protein S7 (chloroplast) [Magnolia sinica] ref|YP_008993910.1| ribosomal protein S7 (chloroplast) [Magnolia sprengeri] ref|YP_008993923.1| ribosomal protein S7 (chloroplast) [Magnolia sprengeri] ref|YP_008993738.1| ribosomal protein S7 (chloroplast) [Magnolia salicifolia] ref|YP_008993751.1| ribosomal protein S7 (chloroplast) [Magnolia salicifolia] ref|YP_009048334.1| 30S ribosomal protein S7 (chloroplast) [Magnolia yunnanensis] ref|YP_009048351.1| 30S ribosomal protein S7 (chloroplast) [Magnolia yunnanensis] ref|YP_009234686.1| ribosomal protein S7 (chloroplast) [Meliosma aff. cuneifolia Moore 333] ref|YP_009234699.1| ribosomal protein S7 (chloroplast) [Meliosma aff. cuneifolia Moore 333] ref|YP_009234940.1| ribosomal protein S7 (chloroplast) [Pachysandra terminalis] ref|YP_009234953.1| ribosomal protein S7 (chloroplast) [Pachysandra terminalis] ref|YP_009335633.1| ribosomal protein S7 (chloroplast) [Yucca brevifolia] ref|YP_009335646.1| ribosomal protein S7 (chloroplast) [Yucca brevifolia] ref|YP_009335718.1| ribosomal protein S7 (chloroplast) [Yucca filamentosa] ref|YP_009335731.1| ribosomal protein S7 (chloroplast) [Yucca filamentosa] ref|YP_009335803.1| ribosomal protein S7 (chloroplast) [Yucca queretaroensis] ref|YP_009335816.1| ribosomal protein S7 (chloroplast) [Yucca queretaroensis] ref|YP_009335887.1| ribosomal protein S7 (chloroplast) [Yucca schidigera] ref|YP_009335899.1| ribosomal protein S7 (chloroplast) [Yucca schidigera] ref|YP_009365621.1| ribosomal protein S7 (plastid) [Magnolia biondii] ref|YP_009365634.1| ribosomal protein S7 (plastid) [Magnolia biondii] ref|YP_009416782.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] ref|YP_009416795.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] ref|YP_009429847.1| ribosomal protein S7 (chloroplast) [Magnolia laevifolia] ref|YP_009429860.1| ribosomal protein S7 (chloroplast) [Magnolia laevifolia] ref|YP_009463138.1| ribosomal protein S7 (chloroplast) [Magnolia aromatica] ref|YP_009463151.1| ribosomal protein S7 (chloroplast) [Magnolia aromatica] ref|YP_009463224.1| ribosomal protein S7 (chloroplast) [Magnolia conifera] ref|YP_009463237.1| ribosomal protein S7 (chloroplast) [Magnolia conifera] ref|YP_009463310.1| ribosomal protein S7 (chloroplast) [Magnolia duclouxii] ref|YP_009463323.1| ribosomal protein S7 (chloroplast) [Magnolia duclouxii] ref|YP_009463396.1| ribosomal protein S7 (chloroplast) [Magnolia glaucifolia] ref|YP_009463409.1| ribosomal protein S7 (chloroplast) [Magnolia glaucifolia] ref|YP_009463482.1| ribosomal protein S7 (chloroplast) [Magnolia dandyi] ref|YP_009463495.1| ribosomal protein S7 (chloroplast) [Magnolia dandyi] ref|YP_009463568.1| ribosomal protein S7 (chloroplast) [Magnolia alba] ref|YP_009463581.1| ribosomal protein S7 (chloroplast) [Magnolia alba] sp|Q6KGX6.1|RR7_MAGST RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q67IA4.1|RR7_YUCGL RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAQ14218.1| ribosomal protein S7 (chloroplast) [Magnolia stellata] gb|AAQ64560.1| ribosomal protein S7 (chloroplast) [Pachysandra terminalis] gb|AAN32054.1| ribosomal protein S7 (chloroplast) [Lanaria lanata] gb|AAN32099.1| ribosomal protein S7 (chloroplast) [Yucca glauca] gb|AAZ03888.1| ribosomal protein S7, partial (chloroplast) [Yucca schidigera] gb|ADD29895.1| ribosomal protein S7 (chloroplast) [Meliosma aff. cuneifolia Moore 333] gb|ADL39101.1| ribosomal protein S7 (chloroplast) [Magnolia kwangsiensis] gb|ADL39115.1| ribosomal protein S7 (chloroplast) [Magnolia kwangsiensis] gb|AEK71641.1| ribosomal protein S7 (plastid) [Meliosma aff. cuneifolia Moore 333] gb|AEK71829.1| ribosomal protein S7 (plastid) [Heisteria concinna] gb|AEM65262.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AEM65277.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AEX98296.1| ribosomal protein S7 (chloroplast) [Magnolia liliiflora] gb|AEX98308.1| ribosomal protein S7 (chloroplast) [Magnolia liliiflora] gb|AEX98379.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AEX98392.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AEX98546.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis] gb|AEX98558.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis] gb|AEX98629.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98642.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98713.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98726.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98797.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98810.1| ribosomal protein S7 (chloroplast) [Magnolia officinalis subsp. biloba] gb|AEX98963.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] gb|AEX98976.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] gb|AEX99132.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] gb|AEX99144.1| ribosomal protein S7 (chloroplast) [Magnolia grandiflora] gb|AFP92354.1| ribosomal protein S7 (chloroplast) [Magnolia acuminata var. acuminata] gb|AFP92367.1| ribosomal protein S7 (chloroplast) [Magnolia acuminata var. acuminata] gb|AFP92441.1| ribosomal protein S7 (chloroplast) [Magnolia cathcartii] gb|AFP92454.1| ribosomal protein S7 (chloroplast) [Magnolia cathcartii] gb|AFP92527.1| ribosomal protein S7 (chloroplast) [Magnolia macrophylla var. dealbata] gb|AFP92540.1| ribosomal protein S7 (chloroplast) [Magnolia macrophylla var. dealbata] gb|AFP92613.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AFP92626.1| ribosomal protein S7 (chloroplast) [Magnolia denudata] gb|AFP92699.1| ribosomal protein S7 (chloroplast) [Magnolia pyramidata] gb|AFP92712.1| ribosomal protein S7 (chloroplast) [Magnolia pyramidata] gb|AFP92785.1| ribosomal protein S7 (chloroplast) [Magnolia kobus] gb|AFP92798.1| ribosomal protein S7 (chloroplast) [Magnolia kobus] gb|AFP92871.1| ribosomal protein S7 (chloroplast) [Magnolia liliiflora] gb|AFP92884.1| ribosomal protein S7 (chloroplast) [Magnolia liliiflora] gb|AFP92957.1| ribosomal protein S7 (chloroplast) [Magnolia odora] gb|AFP92970.1| ribosomal protein S7 (chloroplast) [Magnolia odora] gb|AFP93043.1| ribosomal protein S7 (chloroplast) [Magnolia salicifolia] gb|AFP93056.1| ribosomal protein S7 (chloroplast) [Magnolia salicifolia] gb|AFP93129.1| ribosomal protein S7 (chloroplast) [Magnolia sinica] gb|AFP93142.1| ribosomal protein S7 (chloroplast) [Magnolia sinica] gb|AFP93215.1| ribosomal protein S7 (chloroplast) [Magnolia sprengeri] gb|AFP93228.1| ribosomal protein S7 (chloroplast) [Magnolia sprengeri] gb|AHF72125.1| 30S ribosomal protein S7 (chloroplast) [Magnolia yunnanensis] gb|AHF72126.1| 30S ribosomal protein S7 (chloroplast) [Magnolia yunnanensis] gb|AMD08404.1| ribosomal protein S7 (chloroplast) [Meliosma aff. cuneifolia Moore 333] gb|AMD08417.1| ribosomal protein S7 (chloroplast) [Meliosma aff. cuneifolia Moore 333] gb|AMD08658.1| ribosomal protein S7 (chloroplast) [Pachysandra terminalis] gb|AMD08671.1| ribosomal protein S7 (chloroplast) [Pachysandra terminalis] gb|APO12777.1| ribosomal protein S7 (chloroplast) [Yucca brevifolia] gb|APO12790.1| ribosomal protein S7 (chloroplast) [Yucca brevifolia] gb|APO12862.1| ribosomal protein S7 (chloroplast) [Yucca filamentosa] gb|APO12875.1| ribosomal protein S7 (chloroplast) [Yucca filamentosa] gb|APO12947.1| ribosomal protein S7 (chloroplast) [Yucca queretaroensis] gb|APO12960.1| ribosomal protein S7 (chloroplast) [Yucca queretaroensis] gb|APO13031.1| ribosomal protein S7 (chloroplast) [Yucca schidigera] gb|APO13043.1| ribosomal protein S7 (chloroplast) [Yucca schidigera] gb|ARJ61120.1| ribosomal protein S7 (plastid) [Magnolia biondii] gb|ARJ61121.1| ribosomal protein S7 (plastid) [Magnolia biondii] gb|ARJ62984.1| ribosomal protein S7 (plastid) [Magnolia officinalis] gb|ARJ62985.1| ribosomal protein S7 (plastid) [Magnolia officinalis] gb|ARJ63068.1| ribosomal protein S7 (plastid) [Magnolia denudata] gb|ARJ63069.1| ribosomal protein S7 (plastid) [Magnolia denudata] gb|ASF62374.1| ribosomal protein S7 (chloroplast) [Magnolia alba] gb|ASF62375.1| ribosomal protein S7 (chloroplast) [Magnolia alba] gb|ASS35052.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] gb|ASS35053.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] gb|ASX99475.1| ribosomal protein S7 (chloroplast) [Magnolia laevifolia] gb|ASX99488.1| ribosomal protein S7 (chloroplast) [Magnolia laevifolia] gb|AUW35367.1| ribosomal protein S7 (chloroplast) [Magnolia aromatica] gb|AUW35368.1| ribosomal protein S7 (chloroplast) [Magnolia aromatica] gb|AUW35453.1| ribosomal protein S7 (chloroplast) [Magnolia fordiana var. calcarea] gb|AUW35454.1| ribosomal protein S7 (chloroplast) [Magnolia fordiana var. calcarea] gb|AUW35539.1| ribosomal protein S7 (chloroplast) [Magnolia conifera] gb|AUW35540.1| ribosomal protein S7 (chloroplast) [Magnolia conifera] gb|AUW35625.1| ribosomal protein S7 (chloroplast) [Magnolia duclouxii] gb|AUW35626.1| ribosomal protein S7 (chloroplast) [Magnolia duclouxii] gb|AUW35711.1| ribosomal protein S7 (chloroplast) [Magnolia glaucifolia] gb|AUW35712.1| ribosomal protein S7 (chloroplast) [Magnolia glaucifolia] gb|AUW35797.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] gb|AUW35798.1| ribosomal protein S7 (chloroplast) [Magnolia insignis] gb|AUW35883.1| ribosomal protein S7 (chloroplast) [Magnolia dandyi] gb|AUW35884.1| ribosomal protein S7 (chloroplast) [Magnolia dandyi] gb|AUW35969.1| ribosomal protein S7 (chloroplast) [Magnolia alba] gb|AUW35970.1| ribosomal protein S7 (chloroplast) [Magnolia alba] Length = 155 Score = 301 bits (772), Expect = 1e-99 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQI+YRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQILYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009402572.1| ribosomal protein S7 (chloroplast) [Pararchidendron pruinosum] ref|YP_009402594.1| ribosomal protein S7 (chloroplast) [Pararchidendron pruinosum] emb|CUR08478.1| rps7 (chloroplast) [Pararchidendron pruinosum] emb|CUR08491.1| rps7 (chloroplast) [Pararchidendron pruinosum] gb|APA33213.1| ribosomal protein S7 (chloroplast) [Pararchidendron pruinosum] gb|APA33235.1| ribosomal protein S7 (chloroplast) [Pararchidendron pruinosum] Length = 155 Score = 301 bits (771), Expect = 2e-99 Identities = 153/155 (98%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQI+YRA+KKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQILYRAIKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009349320.1| ribosomal protein S7 (chloroplast) [Symplocarpus renifolius] ref|YP_009349333.1| ribosomal protein S7 (chloroplast) [Symplocarpus renifolius] ref|YP_009440719.1| ribosomal protein S7 (chloroplast) [Aristolochia contorta] ref|YP_009440732.1| ribosomal protein S7 (chloroplast) [Aristolochia contorta] ref|YP_009440804.1| ribosomal protein S7 (chloroplast) [Aristolochia debilis] ref|YP_009440817.1| ribosomal protein S7 (chloroplast) [Aristolochia debilis] sp|Q67IP2.1|RR7_BUTUM RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAN31961.1| ribosomal protein S7 (chloroplast) [Butomus umbellatus] gb|AEK71815.1| ribosomal protein S7 (plastid) [Aristolochia littoralis] gb|AEX01284.1| ribosomal protein S7 (plastid) [Posidonia australis] gb|AEX01286.1| ribosomal protein S7 (plastid) [Amphibolis griffithii] gb|AEX01294.1| ribosomal protein S7 (plastid) [Maundia triglochinoides] gb|AEX01297.1| ribosomal protein S7 (plastid) [Triglochin maritima] gb|AEX01300.1| ribosomal protein S7 (plastid) [Aponogeton distachyos] gb|AEX01306.1| ribosomal protein S7 (plastid) [Orontium aquaticum] gb|AEX94144.1| ribosomal protein S7 (chloroplast) [Gilliesia graminea] gb|APZ83186.1| ribosomal protein S7 (chloroplast) [Symplocarpus renifolius] gb|APZ83199.1| ribosomal protein S7 (chloroplast) [Symplocarpus renifolius] gb|ATI10678.1| ribosomal protein S7 (chloroplast) [Aristolochia contorta] gb|ATI10691.1| ribosomal protein S7 (chloroplast) [Aristolochia contorta] gb|ATI10762.1| ribosomal protein S7 (chloroplast) [Aristolochia debilis] gb|ATI10775.1| ribosomal protein S7 (chloroplast) [Aristolochia debilis] Length = 155 Score = 301 bits (771), Expect = 2e-99 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETH+MAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHKMAEANRAFAHFR 155 >sp|Q6EMA4.1|RR7_CANWI RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAQ64536.1| ribosomal protein S7 (chloroplast) [Canella winterana] Length = 155 Score = 301 bits (771), Expect = 2e-99 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGD+IRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDSIRKKEETHRMAEANRAFAHFR 155 >gb|AHF71952.1| 30S ribosomal protein S7 (chloroplast) [Paeonia sp. Sd0052] gb|AHF71953.1| 30S ribosomal protein S7 (chloroplast) [Paeonia sp. Sd0052] Length = 155 Score = 301 bits (771), Expect = 2e-99 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 +SELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 NSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_003587510.1| ribosomal protein S7 (chloroplast) [Oncidium hybrid cultivar] ref|YP_003587516.1| ribosomal protein S7 (chloroplast) [Oncidium hybrid cultivar] ref|YP_006503734.1| ribosomal protein S7 (chloroplast) [Erycina pusilla] ref|YP_006503739.1| ribosomal protein S7 (chloroplast) [Erycina pusilla] ref|YP_008081695.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium sinense] ref|YP_008081704.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium sinense] ref|YP_008081851.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tracyanum] ref|YP_008081860.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tracyanum] ref|YP_008081929.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium mannii] ref|YP_008081938.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium mannii] ref|YP_008081773.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tortisepalum] ref|YP_008081782.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tortisepalum] ref|YP_008081617.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium aloifolium] ref|YP_008081626.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium aloifolium] ref|YP_009026483.1| ribosomal protein S7 (chloroplast) [Dendrobium officinale] ref|YP_009026489.1| ribosomal protein S7 (chloroplast) [Dendrobium officinale] ref|YP_009109176.1| ribosomal protein S7 (plastid) [Corallorhiza trifida] ref|YP_009109182.1| ribosomal protein S7 (plastid) [Corallorhiza trifida] ref|YP_009108970.1| ribosomal protein S7 (plastid) [Corallorhiza bulbosa] ref|YP_009108976.1| ribosomal protein S7 (plastid) [Corallorhiza bulbosa] ref|YP_009122633.1| ribosomal protein S7 (chloroplast) [Masdevallia coccinea] ref|YP_009122646.1| ribosomal protein S7 (chloroplast) [Masdevallia coccinea] ref|YP_009123476.1| 30S ribosomal protein S7 (chloroplast) [Cattleya crispata] ref|YP_009123487.1| 30S ribosomal protein S7 (chloroplast) [Cattleya crispata] ref|YP_009129753.1| ribosomal protein S7 (chloroplast) [Masdevallia picturata] ref|YP_009129739.1| ribosomal protein S7 (chloroplast) [Masdevallia picturata] ref|YP_009161873.1| ribosomal protein S7 (chloroplast) [Dendrobium strongylanthum] ref|YP_009161881.1| ribosomal protein S7 (chloroplast) [Dendrobium strongylanthum] ref|YP_009163445.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium faberi] ref|YP_009163454.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium faberi] ref|YP_009175241.1| ribosomal protein S7 (plastid) [Oncidium sphacelatum] ref|YP_009175248.1| ribosomal protein S7 (plastid) [Oncidium sphacelatum] ref|YP_009180234.1| ribosomal protein S7 (chloroplast) [Dendrobium huoshanense] ref|YP_009180240.1| ribosomal protein S7 (chloroplast) [Dendrobium huoshanense] ref|YP_009183326.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium goeringii] ref|YP_009183335.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium goeringii] ref|YP_009183405.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium ensifolium] ref|YP_009183414.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium ensifolium] ref|YP_009235485.1| ribosomal protein S7 (chloroplast) [Dendrobium nobile] ref|YP_009235496.1| ribosomal protein S7 (chloroplast) [Dendrobium nobile] ref|YP_009239397.1| ribosomal protein S7 (chloroplast) [Dendrobium pendulum] ref|YP_009239403.1| ribosomal protein S7 (chloroplast) [Dendrobium pendulum] ref|YP_009239541.1| ribosomal protein S7 (chloroplast) [Cymbidium kanran] ref|YP_009239549.1| ribosomal protein S7 (chloroplast) [Cymbidium kanran] ref|YP_009328305.1| 30S ribosomal protein S7 (chloroplast) [Cattleya liliputana] ref|YP_009328316.1| 30S ribosomal protein S7 (chloroplast) [Cattleya liliputana] ref|YP_009389024.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium moniliforme] ref|YP_009389030.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium moniliforme] ref|YP_009400643.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium primulinum] ref|YP_009400649.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium primulinum] ref|YP_009400787.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium brymerianum] ref|YP_009400793.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium brymerianum] ref|YP_009401578.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium parciflorum] ref|YP_009401584.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium parciflorum] ref|YP_009401722.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium chrysanthum] ref|YP_009401728.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium chrysanthum] ref|YP_009400715.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium aphyllum] ref|YP_009400721.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium aphyllum] ref|YP_009400859.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium denneanum] ref|YP_009400865.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium denneanum] ref|YP_009400931.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium devonianum] ref|YP_009400937.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium devonianum] ref|YP_009401003.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium falconeri] ref|YP_009401009.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium falconeri] ref|YP_009401075.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium gratiosissimum] ref|YP_009401081.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium gratiosissimum] ref|YP_009401147.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium hercoglossum] ref|YP_009401153.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium hercoglossum] ref|YP_009401218.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium wardianum] ref|YP_009401224.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium wardianum] ref|YP_009401290.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium wilsonii] ref|YP_009401296.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium wilsonii] ref|YP_009401434.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium salaccense] ref|YP_009401440.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium salaccense] ref|YP_009401506.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium spatella] ref|YP_009401512.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium spatella] ref|YP_009401650.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium henryi] ref|YP_009401656.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium henryi] ref|YP_009401794.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium jenkinsii] ref|YP_009401800.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium jenkinsii] ref|YP_009401866.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium lohohense] ref|YP_009401872.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium lohohense] ref|YP_009401938.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium parishii] ref|YP_009401944.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium parishii] ref|YP_009402010.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium ellipsophyllum] ref|YP_009402016.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium ellipsophyllum] ref|YP_009402082.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium xichouense] ref|YP_009402088.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium xichouense] ref|YP_009402154.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium fimbriatum] ref|YP_009402160.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium fimbriatum] ref|YP_009402226.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium exile] ref|YP_009402232.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium exile] ref|YP_009402298.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium fanjingshanense] ref|YP_009402304.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium fanjingshanense] ref|YP_009421656.1| ribosomal protein S7 (plastid) [Dendrobium candidum] ref|YP_009421662.1| ribosomal protein S7 (plastid) [Dendrobium candidum] ref|YP_009443496.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium loddigesii] ref|YP_009443501.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium loddigesii] ref|YP_009470031.1| ribosomal protein S7 (chloroplast) [Eulophia zollingeri] ref|YP_009470039.1| ribosomal protein S7 (chloroplast) [Eulophia zollingeri] gb|ACT83148.1| ribosomal protein S7 (chloroplast) [Oncidium hybrid cultivar] gb|ACT83154.1| ribosomal protein S7 (chloroplast) [Oncidium hybrid cultivar] gb|AEJ72540.1| ribosomal protein S7 (chloroplast) [Erycina pusilla] gb|AEJ72546.1| ribosomal protein S7 (chloroplast) [Erycina pusilla] gb|AGK25272.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium aloifolium] gb|AGK25273.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium aloifolium] gb|AGK25350.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium sinense] gb|AGK25351.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium sinense] gb|AGK25428.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tortisepalum] gb|AGK25429.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tortisepalum] gb|AGK25506.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tortisepalum] gb|AGK25507.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tortisepalum] gb|AGK25584.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium mannii] gb|AGK25585.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium mannii] gb|AGK25662.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tracyanum] gb|AGK25663.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tracyanum] gb|AGK25740.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tortisepalum] gb|AGK25741.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium tortisepalum] gb|AGK25818.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium mannii] gb|AGK25819.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium mannii] gb|AGM48241.1| ribosomal protein S7 (chloroplast) [Dendrobium officinale] gb|AGM48246.1| ribosomal protein S7 (chloroplast) [Dendrobium officinale] gb|AID52135.1| ribosomal protein S7 (chloroplast) [Masdevallia picturata] gb|AID52136.1| ribosomal protein S7 (chloroplast) [Masdevallia picturata] gb|AIR76470.1| ribosomal protein S7 (chloroplast) [Dendrobium officinale] gb|AIR76471.1| ribosomal protein S7 (chloroplast) [Dendrobium officinale] gb|AIS67496.1| ribosomal protein S7 (plastid) [Oncidium sphacelatum] gb|AIS67502.1| ribosomal protein S7 (plastid) [Oncidium sphacelatum] gb|AIW51249.1| ribosomal protein S7 (plastid) [Corallorhiza bulbosa] gb|AIW51256.1| ribosomal protein S7 (plastid) [Corallorhiza bulbosa] gb|AIW51644.1| ribosomal protein S7 (plastid) [Corallorhiza trifida] gb|AIW51652.1| ribosomal protein S7 (plastid) [Corallorhiza trifida] gb|AJJ48556.1| ribosomal protein S7 (chloroplast) [Masdevallia coccinea] gb|AJJ48568.1| ribosomal protein S7 (chloroplast) [Masdevallia coccinea] gb|AJM70448.1| 30S ribosomal protein S7 (chloroplast) [Cattleya crispata] gb|AJM70459.1| 30S ribosomal protein S7 (chloroplast) [Cattleya crispata] gb|AKE36748.1| 30S ribosomal protein S7 (chloroplast) [Cattleya liliputana] gb|AKE36759.1| 30S ribosomal protein S7 (chloroplast) [Cattleya liliputana] gb|AKJ83550.1| ribosomal protein S7 (chloroplast) [Alocasia macrorrhizos] gb|AKJ83551.1| ribosomal protein S7 (chloroplast) [Alocasia macrorrhizos] gb|AKS28619.1| ribosomal protein S7 (chloroplast) [Dendrobium strongylanthum] gb|AKS28620.1| ribosomal protein S7 (chloroplast) [Dendrobium strongylanthum] gb|AKU70893.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium faberi] gb|AKU70894.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium faberi] gb|ALG65752.1| ribosomal protein S7 (chloroplast) [Anoectochilus roxburghii] gb|ALL96583.1| ribosomal protein S7 (chloroplast) [Dendrobium huoshanense] gb|ALL96584.1| ribosomal protein S7 (chloroplast) [Dendrobium huoshanense] gb|ALM87827.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium goeringii] gb|ALM87828.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium goeringii] gb|ALM87905.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium ensifolium] gb|ALM87906.1| 30S ribosomal protein S7 (chloroplast) [Cymbidium ensifolium] gb|AMD15598.1| ribosomal protein S7 (chloroplast) [Dendrobium nobile] gb|AMD15599.1| ribosomal protein S7 (chloroplast) [Dendrobium nobile] gb|AMM05344.1| ribosomal protein S7 (chloroplast) [Dendrobium pendulum] gb|AMM05345.1| ribosomal protein S7 (chloroplast) [Dendrobium pendulum] gb|AMM05745.1| ribosomal protein S7 (chloroplast) [Cymbidium ensifolium] gb|AMM05752.1| ribosomal protein S7 (chloroplast) [Cymbidium ensifolium] gb|AMM05816.1| ribosomal protein S7 (chloroplast) [Cymbidium kanran] gb|AMM05823.1| ribosomal protein S7 (chloroplast) [Cymbidium kanran] gb|AND83266.1| ribosomal protein S7 (chloroplast) [Anoectochilus roxburghii] dbj|BAV37838.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium nobile] dbj|BAV37844.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium nobile] gb|ANZ02144.1| ribosomal protein S7 (chloroplast) [Dendrobium nobile] gb|ANZ02151.1| ribosomal protein S7 (chloroplast) [Dendrobium nobile] gb|AOW68552.1| ribosomal protein S7 (chloroplast) [Dendrobium catenatum] gb|AOW68559.1| ribosomal protein S7 (chloroplast) [Dendrobium catenatum] gb|AOX13337.1| ribosomal protein S7 (chloroplast) [Angelica gigas] gb|AOX13344.1| ribosomal protein S7 (chloroplast) [Angelica gigas] dbj|BAX84215.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium moniliforme] dbj|BAX84221.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium moniliforme] dbj|BAX88256.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium primulinum] dbj|BAX88262.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium primulinum] dbj|BAX88328.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium aphyllum] dbj|BAX88334.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium aphyllum] dbj|BAX88400.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium brymerianum] dbj|BAX88406.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium brymerianum] dbj|BAX88472.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium denneanum] dbj|BAX88478.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium denneanum] dbj|BAX88544.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium devonianum] dbj|BAX88550.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium devonianum] dbj|BAX88616.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium falconeri] dbj|BAX88622.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium falconeri] dbj|BAX88688.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium gratiosissimum] dbj|BAX88694.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium gratiosissimum] dbj|BAX88760.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium hercoglossum] dbj|BAX88766.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium hercoglossum] dbj|BAX88831.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium wardianum] dbj|BAX88837.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium wardianum] dbj|BAX88903.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium wilsonii] dbj|BAX88909.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium wilsonii] dbj|BAX89047.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium salaccense] dbj|BAX89053.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium salaccense] dbj|BAX89119.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium spatella] dbj|BAX89125.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium spatella] dbj|BAX89191.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium parciflorum] dbj|BAX89197.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium parciflorum] dbj|BAX89263.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium henryi] dbj|BAX89269.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium henryi] dbj|BAX89335.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium chrysanthum] dbj|BAX89341.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium chrysanthum] dbj|BAX89407.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium jenkinsii] dbj|BAX89413.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium jenkinsii] dbj|BAX89479.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium lohohense] dbj|BAX89485.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium lohohense] dbj|BAX89551.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium chrysotoxum] dbj|BAX89557.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium chrysotoxum] dbj|BAX89623.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium parishii] dbj|BAX89629.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium parishii] dbj|BAX89695.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium ellipsophyllum] dbj|BAX89701.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium ellipsophyllum] dbj|BAX89767.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium xichouense] dbj|BAX89773.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium xichouense] dbj|BAX89839.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium fimbriatum] dbj|BAX89845.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium fimbriatum] dbj|BAX89911.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium exile] dbj|BAX89917.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium exile] dbj|BAX89983.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium fanjingshanense] dbj|BAX89989.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium fanjingshanense] gb|ASS18523.1| ribosomal protein S7 (plastid) [Dendrobium candidum] gb|ASS18529.1| ribosomal protein S7 (plastid) [Dendrobium candidum] gb|ATJ03067.1| 30S ribosomal protein S7 (chloroplast) [Liparis loeselii] gb|ATJ03068.1| 30S ribosomal protein S7 (chloroplast) [Liparis loeselii] gb|ATJ03261.1| ribosomal protein S7 (chloroplast) [Cymbidium goeringii] gb|ATL23273.1| ribosomal protein S7 (plastid) [Dendrobium hancockii] gb|ATL23279.1| ribosomal protein S7 (plastid) [Dendrobium hancockii] gb|ATR81026.1| ribosomal protein S7 (plastid) [Dendrobium moniliforme] gb|ATR81032.1| ribosomal protein S7 (plastid) [Dendrobium moniliforme] dbj|BBB04130.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium loddigesii] dbj|BBB04135.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium loddigesii] dbj|BBB04199.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium devonianum] dbj|BBB04205.1| 30S ribosomal protein S7 (chloroplast) [Dendrobium devonianum] gb|AVF91728.1| ribosomal protein S7 (chloroplast) [Eulophia zollingeri] gb|AVF91729.1| ribosomal protein S7 (chloroplast) [Eulophia zollingeri] dbj|BBD13624.1| 30S ribosomal protein S7, partial (chloroplast) [Dendrobium huoshanense] dbj|BBD13680.1| 30S ribosomal protein S7, partial (chloroplast) [Dendrobium loddigesii] gb|AVM10520.1| ribosomal protein S7 (chloroplast) [Cremastra appendiculata] gb|AVM10521.1| ribosomal protein S7 (chloroplast) [Cremastra appendiculata] Length = 155 Score = 301 bits (771), Expect = 2e-99 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAF+L Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFRL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|WP_064723896.1| 30S ribosomal protein S7 [Paenarthrobacter nicotinovorans] ref|YP_636344.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus subsp. globulus] ref|YP_636359.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus subsp. globulus] ref|YP_001718482.1| ribosomal protein S7 [Manihot esculenta] ref|YP_001718495.1| ribosomal protein S7 [Manihot esculenta] ref|YP_002720171.1| rps7 [Jatropha curcas] ref|YP_002720158.1| rps7 [Jatropha curcas] ref|YP_003934004.1| ribosomal protein S7 (chloroplast) [Eucalyptus grandis] ref|YP_003934015.1| ribosomal protein S7 (chloroplast) [Eucalyptus grandis] ref|YP_007475665.1| ribosomal protein S7 [Heliconia collinsiana] ref|YP_007475678.1| ribosomal protein S7 [Heliconia collinsiana] ref|YP_007889906.1| ribosomal protein S7 (plastid) [Francoa sonchifolia] ref|YP_007889918.1| ribosomal protein S7 (plastid) [Francoa sonchifolia] ref|YP_008575158.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] ref|YP_008575173.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] ref|YP_008575243.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] ref|YP_008575258.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] ref|YP_008575328.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] ref|YP_008575343.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] ref|YP_008575413.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] ref|YP_008575428.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] ref|YP_008575498.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] ref|YP_008575513.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] ref|YP_008575583.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] ref|YP_008575598.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] ref|YP_008575668.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] ref|YP_008575683.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] ref|YP_008575753.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] ref|YP_008575768.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] ref|YP_008575838.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] ref|YP_008575853.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] ref|YP_008575923.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] ref|YP_008575938.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] ref|YP_008576008.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] ref|YP_008576023.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] ref|YP_008576093.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] ref|YP_008576108.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] ref|YP_008576178.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] ref|YP_008576193.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] ref|YP_008576263.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] ref|YP_008576278.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] ref|YP_008576348.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] ref|YP_008576363.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] ref|YP_008576433.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] ref|YP_008576448.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] ref|YP_008576518.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] ref|YP_008576533.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] ref|YP_008576603.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] ref|YP_008576618.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] ref|YP_008576688.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] ref|YP_008576703.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] ref|YP_008576773.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] ref|YP_008576788.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] ref|YP_008576858.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] ref|YP_008576873.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] ref|YP_008576943.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] ref|YP_008576958.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] ref|YP_008577028.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] ref|YP_008577043.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] ref|YP_008577113.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] ref|YP_008577128.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] ref|YP_008577198.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] ref|YP_008577213.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] ref|YP_008577283.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] ref|YP_008577298.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] ref|YP_008577368.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] ref|YP_008577383.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] ref|YP_008577453.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] ref|YP_008577468.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] ref|YP_008577538.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] ref|YP_008577553.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] ref|YP_008577623.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] ref|YP_008577638.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] ref|YP_008577793.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] ref|YP_008577808.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] ref|YP_008577878.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] ref|YP_008577893.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] ref|YP_008577963.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] ref|YP_008577978.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] ref|YP_008578048.1| ribosomal protein S7 (chloroplast) [Angophora costata] ref|YP_008578063.1| ribosomal protein S7 (chloroplast) [Angophora costata] ref|YP_008578218.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] ref|YP_008578233.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] ref|YP_008578133.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] ref|YP_008578148.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] ref|YP_008854471.1| ribosomal protein S7 [Musa textilis] ref|YP_008854484.1| ribosomal protein S7 [Musa textilis] ref|YP_008963524.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] ref|YP_008963537.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] ref|YP_008994335.1| ribosomal protein S7 (plastid) [Melianthus villosus] ref|YP_008994345.1| ribosomal protein S7 (plastid) [Melianthus villosus] ref|YP_009028513.1| ribosomal protein S7 (chloroplast) [Parinari campestris] ref|YP_009028526.1| ribosomal protein S7 (chloroplast) [Parinari campestris] ref|YP_009111699.1| ribosomal protein S7 (chloroplast) [Apios americana] ref|YP_009111713.1| ribosomal protein S7 (chloroplast) [Apios americana] ref|YP_009163525.1| ribosomal protein S7 (plastid) [Eugenia uniflora] ref|YP_009163538.1| ribosomal protein S7 (plastid) [Eugenia uniflora] ref|YP_009179553.1| ribosomal protein S7 (chloroplast) [Corymbia henryi] ref|YP_009179568.1| ribosomal protein S7 (chloroplast) [Corymbia henryi] ref|YP_009179638.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] ref|YP_009179652.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] ref|YP_009180417.1| ribosomal protein S7 (chloroplast) [Musa balbisiana] ref|YP_009180433.1| ribosomal protein S7 (chloroplast) [Musa balbisiana] ref|YP_009193210.1| ribosomal protein S7 (chloroplast) [Leucaena trichandra] ref|YP_009193224.1| ribosomal protein S7 (chloroplast) [Leucaena trichandra] ref|YP_009253606.1| ribosomal protein S7 (chloroplast) [Senna tora] ref|YP_009253620.1| ribosomal protein S7 (chloroplast) [Senna tora] ref|YP_009264736.1| ribosomal protein S7 (chloroplast) [Kostermanthus robustus] ref|YP_009264749.1| ribosomal protein S7 (chloroplast) [Kostermanthus robustus] ref|YP_009265979.1| ribosomal protein S7 (chloroplast) [Neocarya macrophylla] ref|YP_009265992.1| ribosomal protein S7 (chloroplast) [Neocarya macrophylla] ref|YP_009266062.1| ribosomal protein S7 (chloroplast) [Parinari capensis] ref|YP_009266075.1| ribosomal protein S7 (chloroplast) [Parinari capensis] ref|YP_009266145.1| ribosomal protein S7 (chloroplast) [Parinari curatellifolia] ref|YP_009266158.1| ribosomal protein S7 (chloroplast) [Parinari curatellifolia] ref|YP_009266228.1| ribosomal protein S7 (chloroplast) [Parinari oblongifolia] ref|YP_009266241.1| ribosomal protein S7 (chloroplast) [Parinari oblongifolia] ref|YP_009307088.1| ribosomal protein S7 (chloroplast) [Ludwigia octovalvis] ref|YP_009307100.1| ribosomal protein S7 (chloroplast) [Ludwigia octovalvis] ref|YP_009318672.1| ribosomal protein S7 (chloroplast) [Allomaieta villosa] ref|YP_009318686.1| ribosomal protein S7 (chloroplast) [Allomaieta villosa] ref|YP_009318757.1| ribosomal protein S7 (chloroplast) [Bertolonia acuminata] ref|YP_009318771.1| ribosomal protein S7 (chloroplast) [Bertolonia acuminata] ref|YP_009318842.1| ribosomal protein S7 (chloroplast) [Blakea schlimii] ref|YP_009318856.1| ribosomal protein S7 (chloroplast) [Blakea schlimii] ref|YP_009319011.1| ribosomal protein S7 (chloroplast) [Graffenrieda moritziana] ref|YP_009319025.1| ribosomal protein S7 (chloroplast) [Graffenrieda moritziana] ref|YP_009319096.1| ribosomal protein S7 (chloroplast) [Henriettea barkeri] ref|YP_009319110.1| ribosomal protein S7 (chloroplast) [Henriettea barkeri] ref|YP_009319181.1| ribosomal protein S7 (chloroplast) [Merianthera pulchra] ref|YP_009319195.1| ribosomal protein S7 (chloroplast) [Merianthera pulchra] ref|YP_009319436.1| ribosomal protein S7 (chloroplast) [Opisthocentra clidemioides] ref|YP_009319450.1| ribosomal protein S7 (chloroplast) [Opisthocentra clidemioides] ref|YP_009319520.1| ribosomal protein S7 (chloroplast) [Pterogastra divaricata] ref|YP_009319534.1| ribosomal protein S7 (chloroplast) [Pterogastra divaricata] ref|YP_009319605.1| ribosomal protein S7 (chloroplast) [Rhexia virginica] ref|YP_009319619.1| ribosomal protein S7 (chloroplast) [Rhexia virginica] ref|YP_009319858.1| ribosomal protein S7 (chloroplast) [Tibouchina longifolia] ref|YP_009319872.1| ribosomal protein S7 (chloroplast) [Tibouchina longifolia] ref|YP_009319943.1| ribosomal protein S7 (chloroplast) [Triolena amazonica] ref|YP_009319957.1| ribosomal protein S7 (chloroplast) [Triolena amazonica] ref|YP_009338882.1| ribosomal protein S7 (chloroplast) [Psidium guajava] ref|YP_009338895.1| ribosomal protein S7 (chloroplast) [Psidium guajava] ref|YP_009348398.1| ribosomal protein S7 (chloroplast) [Euphorbia esula] ref|YP_009348411.1| ribosomal protein S7 (chloroplast) [Euphorbia esula] ref|YP_009368002.1| ribosomal protein S7 (chloroplast) [Melastoma candidum] ref|YP_009368018.1| ribosomal protein S7 (chloroplast) [Melastoma candidum] ref|YP_009368412.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus mongolicus] ref|YP_009368428.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus mongolicus] ref|YP_009368497.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus nanus] ref|YP_009368513.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus nanus] ref|YP_009370942.1| ribosomal protein S7 (chloroplast) [Plinia trunciflora] ref|YP_009370955.1| ribosomal protein S7 (chloroplast) [Plinia trunciflora] ref|YP_009365372.1| ribosomal protein S7 (plastid) [Pimenta dioica] ref|YP_009365387.1| ribosomal protein S7 (plastid) [Pimenta dioica] ref|YP_009382922.1| ribosomal protein S7 (chloroplast) [Adenanthera microsperma] ref|YP_009382935.1| ribosomal protein S7 (chloroplast) [Adenanthera microsperma] ref|YP_009383272.1| ribosomal protein S7 (chloroplast) [Piptadenia communis] ref|YP_009383285.1| ribosomal protein S7 (chloroplast) [Piptadenia communis] ref|YP_009390854.1| ribosomal protein S7 (chloroplast) [Punica granatum] ref|YP_009390867.1| ribosomal protein S7 (chloroplast) [Punica granatum] ref|YP_009416905.1| ribosomal protein S7 (chloroplast) [Barthea barthei] ref|YP_009416917.1| ribosomal protein S7 (chloroplast) [Barthea barthei] ref|YP_009420618.1| ribosomal protein S7 (chloroplast) [Musa itinerans] ref|YP_009420634.1| ribosomal protein S7 (chloroplast) [Musa itinerans] ref|YP_009433660.1| ribosomal protein S7 (chloroplast) [Tigridiopalma magnifica] ref|YP_009433674.1| ribosomal protein S7 (chloroplast) [Tigridiopalma magnifica] ref|YP_009437687.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] ref|YP_009437699.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] ref|YP_009454019.1| ribosomal protein S7 (chloroplast) [Vachellia flava] ref|YP_009454033.1| ribosomal protein S7 (chloroplast) [Vachellia flava] ref|YP_009454101.1| ribosomal protein S7 (chloroplast) [Vachellia seyal] ref|YP_009454115.1| ribosomal protein S7 (chloroplast) [Vachellia seyal] ref|YP_009454183.1| ribosomal protein S7 (chloroplast) [Senegalia laeta] ref|YP_009454197.1| ribosomal protein S7 (chloroplast) [Senegalia laeta] ref|YP_009455538.1| ribosomal protein S7 (chloroplast) [Cercis glabra] ref|YP_009455551.1| ribosomal protein S7 (chloroplast) [Cercis glabra] ref|XP_020539073.1| uncharacterized protein LOC110010590 [Jatropha curcas] sp|Q49KT8.1|RR7_EUCGG RecName: Full=30S ribosomal protein S7, chloroplastic sp|B1NWJ5.1|RR7_MANES RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAN31997.1| ribosomal protein S7 (chloroplast) [Hydrothrix gardneri] gb|AAN32019.1| ribosomal protein S7 (chloroplast) [Xiphidium caeruleum] gb|AAX21072.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus subsp. globulus] gb|AAX21089.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus subsp. globulus] gb|ABQ14878.1| ribosomal protein S7 (chloroplast) [Myriophyllum spicatum] gb|ABQ14894.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] gb|ABR23076.1| ribosomal protein S7 (plastid) [Anigozanthos flavidus] gb|ABR23084.1| ribosomal protein S7 (plastid) [Eichhornia crassipes] gb|ABU85417.1| ribosomal protein S7, partial (chloroplast) [Musa acuminata] gb|ABV66199.1| ribosomal protein S7 (chloroplast) [Manihot esculenta] gb|ABV66213.1| ribosomal protein S7 (chloroplast) [Manihot esculenta] gb|ACN72749.1| rps7 (chloroplast) [Jatropha curcas] gb|ACN72756.1| rps7 (chloroplast) [Jatropha curcas] gb|ADD29906.1| ribosomal protein S7 (chloroplast) [Gunnera manicata] gb|ADD29909.1| ribosomal protein S7 (chloroplast) [Oxalis latifolia] gb|ADH94389.1| ribosomal protein S7 (chloroplast) [Syzygium cumini] gb|ADH94402.1| ribosomal protein S7 (chloroplast) [Syzygium cumini] gb|ADO23632.1| ribosomal protein S7 (chloroplast) [Eucalyptus grandis] gb|ADO23644.1| ribosomal protein S7 (chloroplast) [Eucalyptus grandis] gb|AEK71541.1| ribosomal protein S7 (plastid) [Phyllanthus calycinus] gb|AEK71559.1| ribosomal protein S7 (plastid) [Quillaja saponaria] gb|AEK71732.1| ribosomal protein S7 (plastid) [Oxalis latifolia] gb|AEK71746.1| ribosomal protein S7 (plastid) [Gunnera manicata] gb|AEK71801.1| ribosomal protein S7 (plastid) [Erythrospermum phytolaccoides] gb|AEK71808.1| ribosomal protein S7 (plastid) [Caryocar glabrum] gb|AEK78161.1| ribosomal protein S7 (plastid) [Myrtus communis] gb|AFJ00516.1| ribosomal protein S7 (plastid) [Francoa sonchifolia] gb|AFJ00529.1| ribosomal protein S7 (plastid) [Francoa sonchifolia] gb|AFR25704.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] gb|AFR25717.1| ribosomal protein S7 (chloroplast) [Penthorum chinense] gb|AGC56397.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] gb|AGC56412.1| ribosomal protein S7 (chloroplast) [Eucalyptus obliqua] gb|AGC56482.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] gb|AGC56497.1| ribosomal protein S7 (chloroplast) [Eucalyptus radiata] gb|AGC56567.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] gb|AGC56582.1| ribosomal protein S7 (chloroplast) [Eucalyptus delegatensis] gb|AGC56652.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] gb|AGC56667.1| ribosomal protein S7 (chloroplast) [Eucalyptus verrucata] gb|AGC56737.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] gb|AGC56752.1| ribosomal protein S7 (chloroplast) [Eucalyptus baxteri] gb|AGC56822.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] gb|AGC56837.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversifolia] gb|AGC56907.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] gb|AGC56922.1| ribosomal protein S7 (chloroplast) [Eucalyptus sieberi] gb|AGC56992.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] gb|AGC57007.1| ribosomal protein S7 (chloroplast) [Eucalyptus elata] gb|AGC57077.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] gb|AGC57092.1| ribosomal protein S7 (chloroplast) [Eucalyptus regnans] gb|AGC57162.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] gb|AGC57177.1| ribosomal protein S7 (chloroplast) [Eucalyptus umbra] gb|AGC57247.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] gb|AGC57262.1| ribosomal protein S7 (chloroplast) [Eucalyptus cloeziana] gb|AGC57332.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] gb|AGC57347.1| ribosomal protein S7 (chloroplast) [Eucalyptus patens] gb|AGC57417.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] gb|AGC57432.1| ribosomal protein S7 (chloroplast) [Eucalyptus marginata] gb|AGC57502.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] gb|AGC57517.1| ribosomal protein S7 (chloroplast) [Eucalyptus curtisii] gb|AGC57587.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gb|AGC57602.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gb|AGC57672.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gb|AGC57687.1| ribosomal protein S7 (chloroplast) [Eucalyptus melliodora] gb|AGC57757.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] gb|AGC57772.1| ribosomal protein S7 (chloroplast) [Eucalyptus polybractea] gb|AGC57842.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] gb|AGC57857.1| ribosomal protein S7 (chloroplast) [Eucalyptus cladocalyx] gb|AGC57927.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus] gb|AGC57942.1| ribosomal protein S7 (chloroplast) [Eucalyptus globulus] gb|AGC58012.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] gb|AGC58027.1| ribosomal protein S7 (chloroplast) [Eucalyptus nitens] gb|AGC58097.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] gb|AGC58112.1| ribosomal protein S7 (chloroplast) [Eucalyptus aromaphloia] gb|AGC58182.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] gb|AGC58197.1| ribosomal protein S7 (chloroplast) [Eucalyptus saligna] gb|AGC58267.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] gb|AGC58282.1| ribosomal protein S7 (chloroplast) [Eucalyptus camaldulensis] gb|AGC58352.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] gb|AGC58367.1| ribosomal protein S7 (chloroplast) [Eucalyptus deglupta] gb|AGC58437.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] gb|AGC58452.1| ribosomal protein S7 (chloroplast) [Eucalyptus spathulata] gb|AGC58522.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] gb|AGC58537.1| ribosomal protein S7 (chloroplast) [Eucalyptus torquata] gb|AGC58607.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] gb|AGC58622.1| ribosomal protein S7 (chloroplast) [Eucalyptus diversicolor] gb|AGC58692.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] gb|AGC58707.1| ribosomal protein S7 (chloroplast) [Eucalyptus salmonophloia] gb|AGC58777.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] gb|AGC58792.1| ribosomal protein S7 (chloroplast) [Eucalyptus microcorys] gb|AGC58862.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] gb|AGC58877.1| ribosomal protein S7 (chloroplast) [Eucalyptus guilfoylei] gb|AGC58947.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] gb|AGC58962.1| ribosomal protein S7 (chloroplast) [Eucalyptus erythrocorys] gb|AGC59032.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] gb|AGC59047.1| ribosomal protein S7 (chloroplast) [Corymbia gummifera] gb|AGC59202.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] gb|AGC59217.1| ribosomal protein S7 (chloroplast) [Corymbia eximia] gb|AGC59287.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] gb|AGC59302.1| ribosomal protein S7 (chloroplast) [Corymbia tessellaris] gb|AGC59372.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] gb|AGC59387.1| ribosomal protein S7 (chloroplast) [Angophora floribunda] gb|AGC59457.1| ribosomal protein S7 (chloroplast) [Angophora costata] gb|AGC59472.1| ribosomal protein S7 (chloroplast) [Angophora costata] gb|AGC59542.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] gb|AGC59557.1| ribosomal protein S7 (chloroplast) [Allosyncarpia ternata] gb|AGC59627.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] gb|AGC59642.1| ribosomal protein S7 (chloroplast) [Stockwellia quadrifida] gb|AGE92729.1| ribosomal protein S7 (plastid) [Heliconia collinsiana] gb|AGE92744.1| ribosomal protein S7 (plastid) [Heliconia collinsiana] gb|AGE93501.1| ribosomal protein S7 (plastid) [Xiphidium caeruleum] gb|AGE93516.1| ribosomal protein S7 (plastid) [Xiphidium caeruleum] gb|EMS51193.1| 30S ribosomal protein S7, chloroplastic [Triticum urartu] emb|CCW72423.1| rps7 (chloroplast) [Musa acuminata subsp. malaccensis] emb|CCW72442.1| rps7 (chloroplast) [Musa acuminata subsp. malaccensis] gb|AGS13053.1| ribosomal protein S7 (plastid) [Melianthus villosus] gb|AGS13065.1| ribosomal protein S7 (plastid) [Melianthus villosus] gb|AHA12560.1| ribosomal protein S7 (plastid) [Musa textilis] gb|AHA12574.1| ribosomal protein S7 (plastid) [Musa textilis] gb|AHA13056.1| ribosomal protein S7 (plastid) [Costus pulverulentus] gb|AHA13070.1| ribosomal protein S7 (plastid) [Costus pulverulentus] gb|AHI95828.1| ribosomal protein S7 (chloroplast) [Apios americana] gb|AHI95843.1| ribosomal protein S7 (chloroplast) [Apios americana] gb|AHI95911.1| ribosomal protein S7 (chloroplast) [Cercis canadensis] gb|AHI95925.1| ribosomal protein S7 (chloroplast) [Cercis canadensis] gb|AHX81233.1| ribosomal protein S7 (chloroplast) [Parinari campestris] gb|AHX81234.1| ribosomal protein S7 (chloroplast) [Parinari campestris] gb|AHY32854.1| ribosomal protein S7 (chloroplast) [Libidibia coriaria] gb|AHY32868.1| ribosomal protein S7 (chloroplast) [Libidibia coriaria] gb|AHY32937.1| ribosomal protein S7 (chloroplast) [Ceratonia siliqua] gb|AHY32951.1| ribosomal protein S7 (chloroplast) [Ceratonia siliqua] gb|AHY33020.1| ribosomal protein S7 (chloroplast) [Haematoxylum brasiletto] gb|AHY33034.1| ribosomal protein S7 (chloroplast) [Haematoxylum brasiletto] gb|AHY33351.1| ribosomal protein S7 (chloroplast) [Prosopis glandulosa] gb|AHY33365.1| ribosomal protein S7 (chloroplast) [Prosopis glandulosa] gb|KCW58507.1| hypothetical protein EUGRSUZ_H01180 [Eucalyptus grandis] gb|AJE71841.1| ribosomal protein S7 (plastid) [Amorpha canescens] gb|AJE71983.1| ribosomal protein S7 (plastid) [Baptisia bracteata] gb|AJE72054.1| ribosomal protein S7 (plastid) [Chamaecrista fasciculata] gb|AJE72409.1| ribosomal protein S7 (plastid) [Baptisia alba] gb|AJE72693.1| ribosomal protein S7 (plastid) [Amorpha fruticosa] gb|AJE72977.1| ribosomal protein S7 (plastid) [Desmanthus illinoensis] gb|AJZ71638.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AJZ71653.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AKC98549.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. citriodora] gb|AKC98564.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. citriodora] gb|AKC98634.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AKC98649.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AKC98719.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AKC98733.1| ribosomal protein S7 (chloroplast) [Corymbia citriodora subsp. variegata] gb|AKC98803.1| ribosomal protein S7 (chloroplast) [Corymbia henryi] gb|AKC98818.1| ribosomal protein S7 (chloroplast) [Corymbia henryi] gb|AKC98888.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC98902.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC98972.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC98986.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC99056.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC99070.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC99140.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKC99155.1| ribosomal protein S7 (chloroplast) [Corymbia torelliana] gb|AKU71522.1| ribosomal protein S7 (plastid) [Eugenia uniflora] gb|AKU71535.1| ribosomal protein S7 (plastid) [Eugenia uniflora] gb|ALF03795.1| ribosomal protein S7 (chloroplast) [Senna tora] gb|ALF03809.1| ribosomal protein S7 (chloroplast) [Senna tora] gb|ALL97085.1| ribosomal protein S7 (chloroplast) [Musa balbisiana] gb|ALL97100.1| ribosomal protein S7 (chloroplast) [Musa balbisiana] gb|ALQ11593.1| ribosomal protein S7 (chloroplast) [Leucaena trichandra] gb|ALQ11607.1| ribosomal protein S7 (chloroplast) [Leucaena trichandra] gb|AMC32658.1| ribosomal protein S7 (chloroplast) [Chamaecrista fasciculata] gb|AMC32661.1| ribosomal protein S7 (chloroplast) [Croton texensis] gb|AMC32663.1| ribosomal protein S7 (chloroplast) [Euphorbia esula] gb|AMC32670.1| ribosomal protein S7 (chloroplast) [Oxalis dillenii] gb|AMC32677.1| ribosomal protein S7 (chloroplast) [Senna marilandica] gb|ANJ19019.1| ribosomal protein S7 (chloroplast) [Kostermanthus robustus] gb|ANJ19020.1| ribosomal protein S7 (chloroplast) [Kostermanthus robustus] gb|ANJ20282.1| ribosomal protein S7 (chloroplast) [Neocarya macrophylla] gb|ANJ20297.1| ribosomal protein S7 (chloroplast) [Neocarya macrophylla] gb|ANJ20429.1| ribosomal protein S7 (chloroplast) [Parinari capensis] gb|ANJ20430.1| ribosomal protein S7 (chloroplast) [Parinari capensis] gb|ANJ20531.1| ribosomal protein S7 (chloroplast) [Parinari curatellifolia] gb|ANJ20546.1| ribosomal protein S7 (chloroplast) [Parinari curatellifolia] gb|ANJ20614.1| ribosomal protein S7 (chloroplast) [Parinari oblongifolia] gb|ANJ20629.1| ribosomal protein S7 (chloroplast) [Parinari oblongifolia] gb|ANW36992.1| ribosomal protein S7 (chloroplast) [Plinia trunciflora] gb|ANW37005.1| ribosomal protein S7 (chloroplast) [Plinia trunciflora] gb|ANY60384.1| ribosomal protein S7 (chloroplast) [Mezoneuron cucullatum] gb|ANY60385.1| ribosomal protein S7 (chloroplast) [Mezoneuron cucullatum] gb|ANZ53404.1| ribosomal protein S7 (chloroplast) [Psidium guajava] gb|ANZ53417.1| ribosomal protein S7 (chloroplast) [Psidium guajava] gb|AOR53539.1| ribosomal protein S7 (chloroplast) [Ludwigia octovalvis] gb|AOR53540.1| ribosomal protein S7 (chloroplast) [Ludwigia octovalvis] gb|APA17762.1| ribosomal protein S7 (chloroplast) [Allomaieta villosa] gb|APA17763.1| ribosomal protein S7 (chloroplast) [Allomaieta villosa] gb|APA17847.1| ribosomal protein S7 (chloroplast) [Bertolonia acuminata] gb|APA17848.1| ribosomal protein S7 (chloroplast) [Bertolonia acuminata] gb|APA17932.1| ribosomal protein S7 (chloroplast) [Blakea schlimii] gb|APA17933.1| ribosomal protein S7 (chloroplast) [Blakea schlimii] gb|APA18101.1| ribosomal protein S7 (chloroplast) [Graffenrieda moritziana] gb|APA18102.1| ribosomal protein S7 (chloroplast) [Graffenrieda moritziana] gb|APA18186.1| ribosomal protein S7 (chloroplast) [Henriettea barkeri] gb|APA18187.1| ribosomal protein S7 (chloroplast) [Henriettea barkeri] gb|APA18271.1| ribosomal protein S7 (chloroplast) [Merianthera pulchra] gb|APA18272.1| ribosomal protein S7 (chloroplast) [Merianthera pulchra] gb|APA18525.1| ribosomal protein S7 (chloroplast) [Opisthocentra clidemioides] gb|APA18526.1| ribosomal protein S7 (chloroplast) [Opisthocentra clidemioides] gb|APA18610.1| ribosomal protein S7 (chloroplast) [Pterogastra divaricata] gb|APA18611.1| ribosomal protein S7 (chloroplast) [Pterogastra divaricata] gb|APA18694.1| ribosomal protein S7 (chloroplast) [Rhexia virginica] gb|APA18695.1| ribosomal protein S7 (chloroplast) [Rhexia virginica] gb|APA18948.1| ribosomal protein S7 (chloroplast) [Tibouchina longifolia] gb|APA18949.1| ribosomal protein S7 (chloroplast) [Tibouchina longifolia] gb|APA19032.1| ribosomal protein S7 (chloroplast) [Triolena amazonica] gb|APA19033.1| ribosomal protein S7 (chloroplast) [Triolena amazonica] gb|APA32773.1| ribosomal protein S7 (chloroplast) [Adenanthera microsperma] gb|APA32786.1| ribosomal protein S7 (chloroplast) [Adenanthera microsperma] gb|APA33388.1| ribosomal protein S7 (chloroplast) [Piptadenia communis] gb|APA33401.1| ribosomal protein S7 (chloroplast) [Piptadenia communis] gb|API83280.1| ribosomal protein S7 (chloroplast) [Acca sellowiana] gb|API83293.1| ribosomal protein S7 (chloroplast) [Acca sellowiana] gb|APY18520.1| ribosomal protein S7 (chloroplast) [Euphorbia esula] gb|APY18533.1| ribosomal protein S7 (chloroplast) [Euphorbia esula] gb|ARJ60873.1| ribosomal protein S7 (plastid) [Pimenta dioica] gb|ARJ60874.1| ribosomal protein S7 (plastid) [Pimenta dioica] gb|ARK36917.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus mongolicus] gb|ARK36935.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus mongolicus] gb|ARK37002.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus nanus] gb|ARK37020.1| ribosomal protein S7 (chloroplast) [Ammopiptanthus nanus] gb|ARM18862.1| ribosomal protein S7 (chloroplast) [Melastoma candidum] gb|ARM18878.1| ribosomal protein S7 (chloroplast) [Melastoma candidum] gb|ARV86981.1| ribosomal protein S7 (chloroplast) [Psidium guajava] gb|ARV86996.1| ribosomal protein S7 (chloroplast) [Psidium guajava] gb|ARV87317.1| ribosomal protein S7 (chloroplast) [Punica granatum] gb|ARV87331.1| ribosomal protein S7 (chloroplast) [Punica granatum] gb|ASO76306.1| ribosomal protein S7 (chloroplast) [Musa itinerans] gb|ASO76322.1| ribosomal protein S7 (chloroplast) [Musa itinerans] gb|AST09168.1| ribosomal protein S7 (chloroplast) [Barthea barthei] gb|AST09180.1| ribosomal protein S7 (chloroplast) [Barthea barthei] gb|ATD86241.1| ribosomal protein S7 (chloroplast) [Tigridiopalma magnifica] gb|ATD86255.1| ribosomal protein S7 (chloroplast) [Tigridiopalma magnifica] gb|ATE89238.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] gb|ATE89250.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] gb|ATG28274.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] gb|ATG28286.1| ribosomal protein S7 (chloroplast) [Sophora alopecuroides] gb|ATL23358.1| ribosomal protein S7 (chloroplast) [Salweenia bouffordiana] gb|ATL23359.1| ribosomal protein S7 (chloroplast) [Salweenia bouffordiana] gb|ATO58841.1| ribosomal protein S7 (chloroplast) [Styphnolobium japonicum f. violaceum] gb|ATO58854.1| ribosomal protein S7 (chloroplast) [Styphnolobium japonicum f. violaceum] gb|ATO88769.1| ribosomal protein S7 (chloroplast) [Vachellia flava] gb|ATO88770.1| ribosomal protein S7 (chloroplast) [Vachellia flava] gb|ATO88851.1| ribosomal protein S7 (chloroplast) [Vachellia nilotica subsp. tomentosa] gb|ATO88852.1| ribosomal protein S7 (chloroplast) [Vachellia nilotica subsp. tomentosa] gb|ATO88933.1| ribosomal protein S7 (chloroplast) [Vachellia tortilis subsp. raddiana] gb|ATO88934.1| ribosomal protein S7 (chloroplast) [Vachellia tortilis subsp. raddiana] gb|ATO89097.1| ribosomal protein S7 (chloroplast) [Vachellia seyal] gb|ATO89098.1| ribosomal protein S7 (chloroplast) [Vachellia seyal] gb|ATO89278.1| ribosomal protein S7 (chloroplast) [Senegalia laeta] gb|ATO89292.1| ribosomal protein S7 (chloroplast) [Senegalia laeta] gb|ATO89015.1| ribosomal protein S7 (chloroplast) [Vachellia tortilis subsp. raddiana] gb|ATO89016.1| ribosomal protein S7 (chloroplast) [Vachellia tortilis subsp. raddiana] gb|AUG83534.1| ribosomal protein S7 (chloroplast) [Cercis glabra] gb|AUG83547.1| ribosomal protein S7 (chloroplast) [Cercis glabra] gb|AVE14535.1| ribosomal protein S7 (chloroplast) [Angelica tsinlingensis] gb|AVE14536.1| ribosomal protein S7 (chloroplast) [Angelica tsinlingensis] Length = 155 Score = 301 bits (771), Expect = 2e-99 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRA+KKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009028181.1| ribosomal protein S7 (chloroplast) [Couepia guianensis] ref|YP_009028194.1| ribosomal protein S7 (chloroplast) [Couepia guianensis] ref|YP_009263242.1| ribosomal protein S7 (chloroplast) [Couepia caryophylloides] ref|YP_009263255.1| ribosomal protein S7 (chloroplast) [Couepia caryophylloides] ref|YP_009263325.1| ribosomal protein S7 (chloroplast) [Couepia grandiflora] ref|YP_009263338.1| ribosomal protein S7 (chloroplast) [Couepia grandiflora] ref|YP_009263408.1| ribosomal protein S7 (chloroplast) [Couepia ovalifolia] ref|YP_009263421.1| ribosomal protein S7 (chloroplast) [Couepia ovalifolia] ref|YP_009263491.1| ribosomal protein S7 (chloroplast) [Couepia paraensis] ref|YP_009263504.1| ribosomal protein S7 (chloroplast) [Couepia paraensis] ref|YP_009263574.1| ribosomal protein S7 (chloroplast) [Couepia polyandra] ref|YP_009263587.1| ribosomal protein S7 (chloroplast) [Couepia polyandra] ref|YP_009263657.1| ribosomal protein S7 (chloroplast) [Couepia rankiniae] ref|YP_009263670.1| ribosomal protein S7 (chloroplast) [Couepia rankiniae] ref|YP_009263740.1| ribosomal protein S7 (chloroplast) [Couepia sandwithii] ref|YP_009263753.1| ribosomal protein S7 (chloroplast) [Couepia sandwithii] ref|YP_009263823.1| ribosomal protein S7 (chloroplast) [Couepia subcordata] ref|YP_009263836.1| ribosomal protein S7 (chloroplast) [Couepia subcordata] gb|AHX80901.1| ribosomal protein S7 (chloroplast) [Couepia guianensis] gb|AHX80902.1| ribosomal protein S7 (chloroplast) [Couepia guianensis] gb|ANJ17360.1| ribosomal protein S7 (chloroplast) [Couepia caryophylloides] gb|ANJ17361.1| ribosomal protein S7 (chloroplast) [Couepia caryophylloides] gb|ANJ17443.1| ribosomal protein S7 (chloroplast) [Couepia grandiflora] gb|ANJ17444.1| ribosomal protein S7 (chloroplast) [Couepia grandiflora] gb|ANJ17526.1| ribosomal protein S7 (chloroplast) [Couepia ovalifolia] gb|ANJ17527.1| ribosomal protein S7 (chloroplast) [Couepia ovalifolia] gb|ANJ17609.1| ribosomal protein S7 (chloroplast) [Couepia paraensis] gb|ANJ17610.1| ribosomal protein S7 (chloroplast) [Couepia paraensis] gb|ANJ17692.1| ribosomal protein S7 (chloroplast) [Couepia paraensis subsp. cerradoana] gb|ANJ17693.1| ribosomal protein S7 (chloroplast) [Couepia paraensis subsp. cerradoana] gb|ANJ17775.1| ribosomal protein S7 (chloroplast) [Couepia polyandra] gb|ANJ17776.1| ribosomal protein S7 (chloroplast) [Couepia polyandra] gb|ANJ17858.1| ribosomal protein S7 (chloroplast) [Couepia rankiniae] gb|ANJ17859.1| ribosomal protein S7 (chloroplast) [Couepia rankiniae] gb|ANJ17941.1| ribosomal protein S7 (chloroplast) [Couepia sandwithii] gb|ANJ17942.1| ribosomal protein S7 (chloroplast) [Couepia sandwithii] gb|ANJ18024.1| ribosomal protein S7 (chloroplast) [Couepia subcordata] gb|ANJ18025.1| ribosomal protein S7 (chloroplast) [Couepia subcordata] Length = 155 Score = 301 bits (771), Expect = 2e-99 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAE+KTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEQKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|WP_042854974.1| 30S ribosomal protein S7 [Staphylococcus aureus] ref|NP_051104.1| ribosomal protein S7 [Arabidopsis thaliana] ref|NP_051118.1| ribosomal protein S7 [Arabidopsis thaliana] ref|YP_538981.1| ribosomal protein S7 (chloroplast) [Gossypium hirsutum] ref|YP_538994.1| ribosomal protein S7 (chloroplast) [Gossypium hirsutum] ref|YP_913232.1| ribosomal protein S7 [Gossypium barbadense] ref|YP_913245.1| ribosomal protein S7 [Gossypium barbadense] ref|YP_001123419.1| ribosomal protein S7 [Capsella bursa-pastoris] ref|YP_001123435.1| ribosomal protein S7 [Capsella bursa-pastoris] ref|YP_001123332.1| ribosomal protein S7 [Barbarea verna] ref|YP_001123346.1| ribosomal protein S7 [Barbarea verna] ref|YP_001123683.1| ribosomal protein S7 [Lepidium virginicum] ref|YP_001123699.1| ribosomal protein S7 [Lepidium virginicum] ref|YP_001123860.1| ribosomal protein S7 [Nasturtium officinale] ref|YP_001123874.1| ribosomal protein S7 [Nasturtium officinale] ref|YP_001123075.1| ribosomal protein S7 [Aethionema grandiflorum] ref|YP_001123089.1| ribosomal protein S7 [Aethionema grandiflorum] ref|YP_001123160.1| ribosomal protein S7 [Olimarabidopsis pumila] ref|YP_001123174.1| ribosomal protein S7 [Olimarabidopsis pumila] ref|YP_001123245.1| ribosomal protein S7 [Arabis hirsuta] ref|YP_001123259.1| ribosomal protein S7 [Arabis hirsuta] ref|YP_001123508.1| ribosomal protein S7 [Crucihimalaya wallichii] ref|YP_001123524.1| ribosomal protein S7 [Crucihimalaya wallichii] ref|YP_001123596.1| ribosomal protein S7 [Draba nemorosa] ref|YP_001123610.1| ribosomal protein S7 [Draba nemorosa] ref|YP_001123771.1| ribosomal protein S7 [Lobularia maritima] ref|YP_001123787.1| ribosomal protein S7 [Lobularia maritima] ref|YP_001122991.1| ribosomal protein S7 [Aethionema cordifolium] ref|YP_001123005.1| ribosomal protein S7 [Aethionema cordifolium] ref|YP_001671728.1| ribosomal protein S7 [Carica papaya] ref|YP_001671741.1| ribosomal protein S7 [Carica papaya] ref|YP_004021360.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] ref|YP_004021373.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] ref|YP_004286062.1| ribosomal protein S7 [Gossypium thurberi] ref|YP_004286049.1| ribosomal protein S7 [Gossypium thurberi] ref|YP_005087737.1| ribosomal protein S7 (chloroplast) [Gossypium raimondii] ref|YP_005087750.1| ribosomal protein S7 (chloroplast) [Gossypium raimondii] ref|YP_005087833.1| ribosomal protein S7 (chloroplast) [Gossypium darwinii] ref|YP_005087846.1| ribosomal protein S7 (chloroplast) [Gossypium darwinii] ref|YP_005088324.1| ribosomal protein S7 (chloroplast) [Gossypium tomentosum] ref|YP_005088337.1| ribosomal protein S7 (chloroplast) [Gossypium tomentosum] ref|YP_005088420.1| ribosomal protein S7 (chloroplast) [Gossypium herbaceum subsp. africanum] ref|YP_005088433.1| ribosomal protein S7 (chloroplast) [Gossypium herbaceum subsp. africanum] ref|YP_005088960.1| ribosomal protein S7 (chloroplast) [Gossypium mustelinum] ref|YP_005088973.1| ribosomal protein S7 (chloroplast) [Gossypium mustelinum] ref|YP_005089043.1| ribosomal protein S7 (chloroplast) [Gossypium arboreum] ref|YP_005089056.1| ribosomal protein S7 (chloroplast) [Gossypium arboreum] ref|YP_005090012.1| rps7 gene product (chloroplast) [Brassica napus] ref|YP_005089998.1| rps7 gene product (chloroplast) [Brassica napus] ref|YP_006303535.1| ribosomal protein S7 (chloroplast) [Gossypium gossypioides] ref|YP_006303548.1| ribosomal protein S7 (chloroplast) [Gossypium gossypioides] ref|YP_006503321.1| ribosomal protein S7 (chloroplast) [Gossypium incanum] ref|YP_006503334.1| ribosomal protein S7 (chloroplast) [Gossypium incanum] ref|YP_006503404.1| ribosomal protein S7 (chloroplast) [Gossypium somalense] ref|YP_006503417.1| ribosomal protein S7 (chloroplast) [Gossypium somalense] ref|YP_006503487.1| ribosomal protein S7 (chloroplast) [Gossypium capitis-viridis] ref|YP_006503500.1| ribosomal protein S7 (chloroplast) [Gossypium capitis-viridis] ref|YP_006503570.1| ribosomal protein S7 (chloroplast) [Gossypium areysianum] ref|YP_006503583.1| ribosomal protein S7 (chloroplast) [Gossypium areysianum] ref|YP_006503653.1| ribosomal protein S7 (chloroplast) [Gossypium robinsonii] ref|YP_006503666.1| ribosomal protein S7 (chloroplast) [Gossypium robinsonii] ref|YP_006666337.1| ribosomal protein S7 (chloroplast) [Pachycladon enysii] ref|YP_006666351.1| ribosomal protein S7 (chloroplast) [Pachycladon enysii] ref|YP_007889987.1| ribosomal protein S7 (chloroplast) [Pachycladon cheesemanii] ref|YP_007890001.1| ribosomal protein S7 (chloroplast) [Pachycladon cheesemanii] ref|YP_008992523.1| ribosomal protein S7 (chloroplast) [Gossypium anomalum] ref|YP_008992510.1| ribosomal protein S7 (chloroplast) [Gossypium anomalum] ref|YP_008992610.1| ribosomal protein S7 (chloroplast) [Gossypium bickii] ref|YP_008992596.1| ribosomal protein S7 (chloroplast) [Gossypium bickii] ref|YP_008992955.1| ribosomal protein S7 (chloroplast) [Gossypium sturtianum] ref|YP_008992941.1| ribosomal protein S7 (chloroplast) [Gossypium sturtianum] ref|YP_008992696.1| ribosomal protein S7 (chloroplast) [Gossypium herbaceum] ref|YP_008992683.1| ribosomal protein S7 (chloroplast) [Gossypium herbaceum] ref|YP_008992782.1| ribosomal protein S7 (chloroplast) [Gossypium longicalyx] ref|YP_008992769.1| ribosomal protein S7 (chloroplast) [Gossypium longicalyx] ref|YP_008992868.1| ribosomal protein S7 (chloroplast) [Gossypium stocksii] ref|YP_008992855.1| ribosomal protein S7 (chloroplast) [Gossypium stocksii] ref|YP_009000379.1| rps7 protein (chloroplast) [Arabis alpina] ref|YP_009000393.1| rps7 protein (chloroplast) [Arabis alpina] ref|YP_009046960.1| ribosomal protein S7 (chloroplast) [Raphanus sativus] ref|YP_009046974.1| ribosomal protein S7 (chloroplast) [Raphanus sativus] ref|YP_009132993.1| ribosomal protein S7 (chloroplast) [Hibiscus syriacus] ref|YP_009130885.1| ribosomal protein S7 (chloroplast) [Gossypium turneri] ref|YP_009130898.1| ribosomal protein S7 (chloroplast) [Gossypium turneri] ref|YP_009121048.1| ribosomal protein S7 (plastid) [Cardamine impatiens] ref|YP_009121062.1| ribosomal protein S7 (plastid) [Cardamine impatiens] ref|YP_009121133.1| ribosomal protein S7 (plastid) [Cardamine resedifolia] ref|YP_009121147.1| ribosomal protein S7 (plastid) [Cardamine resedifolia] ref|YP_009141996.1| 30S ribosomal protein S7 (chloroplast) [Heloniopsis tubiflora] ref|YP_009142009.1| 30S ribosomal protein S7 (chloroplast) [Heloniopsis tubiflora] ref|YP_009161966.1| ribosomal protein S7 (chloroplast) [Capsella rubella] ref|YP_009161979.1| ribosomal protein S7 (chloroplast) [Capsella rubella] ref|YP_009175735.1| ribosomal protein S7 (chloroplast) [Eutrema salsugineum] ref|YP_009175721.1| ribosomal protein S7 (chloroplast) [Eutrema salsugineum] ref|YP_009177911.1| ribosomal protein S7 (chloroplast) [Brassica juncea] ref|YP_009177924.1| ribosomal protein S7 (chloroplast) [Brassica juncea] ref|YP_009179776.1| ribosomal protein S7 (chloroplast) [Isatis tinctoria] ref|YP_009179790.1| ribosomal protein S7 (chloroplast) [Isatis tinctoria] ref|YP_009182936.1| ribosomal protein S7 (chloroplast) [Capsella grandiflora] ref|YP_009182950.1| ribosomal protein S7 (chloroplast) [Capsella grandiflora] ref|YP_009185389.1| ribosomal protein S7 (plastid) [Tilia amurensis] ref|YP_009185402.1| ribosomal protein S7 (plastid) [Tilia amurensis] ref|YP_009185474.1| ribosomal protein S7 (plastid) [Tilia mandshurica] ref|YP_009185487.1| ribosomal protein S7 (plastid) [Tilia mandshurica] ref|YP_009185559.1| ribosomal protein S7 (plastid) [Tilia oliveri] ref|YP_009185572.1| ribosomal protein S7 (plastid) [Tilia oliveri] ref|YP_009185644.1| ribosomal protein S7 (plastid) [Tilia paucicostata] ref|YP_009185657.1| ribosomal protein S7 (plastid) [Tilia paucicostata] ref|YP_009192761.1| ribosomal protein S7 (chloroplast) [Schrenkiella parvula] ref|YP_009192747.1| ribosomal protein S7 (chloroplast) [Schrenkiella parvula] ref|YP_009192848.1| ribosomal protein S7 (chloroplast) [Eutrema yunnanense] ref|YP_009192834.1| ribosomal protein S7 (chloroplast) [Eutrema yunnanense] ref|YP_009192935.1| ribosomal protein S7 (chloroplast) [Eutrema heterophyllum] ref|YP_009192921.1| ribosomal protein S7 (chloroplast) [Eutrema heterophyllum] ref|YP_009229725.1| ribosomal protein S7 (chloroplast) [Cochlearia borzaeana] ref|YP_009229739.1| ribosomal protein S7 (chloroplast) [Cochlearia borzaeana] ref|YP_009229808.1| ribosomal protein S7 (chloroplast) [Cochlearia islandica] ref|YP_009229822.1| ribosomal protein S7 (chloroplast) [Cochlearia islandica] ref|YP_009230615.1| ribosomal protein S7 (chloroplast) [Cochlearia pyrenaica] ref|YP_009230629.1| ribosomal protein S7 (chloroplast) [Cochlearia pyrenaica] ref|YP_009230698.1| ribosomal protein S7 (chloroplast) [Cochlearia tridactylites] ref|YP_009230712.1| ribosomal protein S7 (chloroplast) [Cochlearia tridactylites] ref|YP_009230781.1| ribosomal protein S7 (chloroplast) [Ionopsidium acaule] ref|YP_009230795.1| ribosomal protein S7 (chloroplast) [Ionopsidium acaule] ref|YP_009230866.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] ref|YP_009230880.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] ref|YP_009230951.1| ribosomal protein S7 (chloroplast) [Arabidopsis cebennensis] ref|YP_009230965.1| ribosomal protein S7 (chloroplast) [Arabidopsis cebennensis] ref|YP_009231036.1| ribosomal protein S7 (chloroplast) [Arabidopsis pedemontana] ref|YP_009231050.1| ribosomal protein S7 (chloroplast) [Arabidopsis pedemontana] ref|YP_009231120.1| ribosomal protein S7 (chloroplast) [Camelina sativa] ref|YP_009231134.1| ribosomal protein S7 (chloroplast) [Camelina sativa] ref|YP_009232402.1| ribosomal protein S7 (chloroplast) [Eutrema halophilum] ref|YP_009232416.1| ribosomal protein S7 (chloroplast) [Eutrema halophilum] ref|YP_009232489.1| ribosomal protein S7 (chloroplast) [Eutrema botschantzevii] ref|YP_009232503.1| ribosomal protein S7 (chloroplast) [Eutrema botschantzevii] ref|YP_009234601.1| ribosomal protein S7 (chloroplast) [Euptelea pleiosperma] ref|YP_009234614.1| ribosomal protein S7 (chloroplast) [Euptelea pleiosperma] ref|YP_009234855.1| ribosomal protein S7 (chloroplast) [Stephania japonica] ref|YP_009234868.1| ribosomal protein S7 (chloroplast) [Stephania japonica] ref|YP_009235028.1| ribosomal protein S7 (chloroplast) [Papaver somniferum] ref|YP_009235041.1| ribosomal protein S7 (chloroplast) [Papaver somniferum] ref|YP_009253781.1| ribosomal protein S7 (chloroplast) [Talipariti hamabo] ref|YP_009253794.1| ribosomal protein S7 (chloroplast) [Talipariti hamabo] ref|YP_009257873.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenicola] ref|YP_009257887.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenicola] ref|YP_009257958.1| ribosomal protein S7 (chloroplast) [Arabidopsis croatica] ref|YP_009257972.1| ribosomal protein S7 (chloroplast) [Arabidopsis croatica] ref|YP_009258043.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta] ref|YP_009258057.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta] ref|YP_009258128.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] ref|YP_009258142.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] ref|YP_009258213.1| ribosomal protein S7 (chloroplast) [Arabidopsis suecica] ref|YP_009258227.1| ribosomal protein S7 (chloroplast) [Arabidopsis suecica] ref|YP_009258298.1| ribosomal protein S7 (chloroplast) [Arabidopsis umezawana] ref|YP_009258312.1| ribosomal protein S7 (chloroplast) [Arabidopsis umezawana] ref|YP_009259625.1| ribosomal protein S7 (chloroplast) [Brassica nigra] ref|YP_009259639.1| ribosomal protein S7 (chloroplast) [Brassica nigra] ref|YP_009261741.1| ribosomal protein S7 (chloroplast) [Pugionium dolabratum] ref|YP_009261755.1| ribosomal protein S7 (chloroplast) [Pugionium dolabratum] ref|YP_009261826.1| ribosomal protein S7 (chloroplast) [Pugionium cornutum] ref|YP_009261840.1| ribosomal protein S7 (chloroplast) [Pugionium cornutum] ref|YP_009271613.1| ribosomal protein S7 (chloroplast) [Cakile arabica] ref|YP_009271627.1| ribosomal protein S7 (chloroplast) [Cakile arabica] ref|YP_009310008.1| ribosomal protein S7 (chloroplast) [Coreanomecon hylomeconoides] ref|YP_009310021.1| ribosomal protein S7 (chloroplast) [Coreanomecon hylomeconoides] ref|YP_009337979.1| ribosomal protein S7 (chloroplast) [Gossypium harknessii] ref|YP_009337992.1| ribosomal protein S7 (chloroplast) [Gossypium harknessii] ref|YP_009341036.1| ribosomal protein S7 (chloroplast) [Gossypium klotzschianum] ref|YP_009341049.1| ribosomal protein S7 (chloroplast) [Gossypium klotzschianum] ref|YP_009341120.1| ribosomal protein S7 (chloroplast) [Gossypium davidsonii] ref|YP_009341133.1| ribosomal protein S7 (chloroplast) [Gossypium davidsonii] ref|YP_009341217.1| ribosomal protein S7 (chloroplast) [Gossypium aridum] ref|YP_009341204.1| ribosomal protein S7 (chloroplast) [Gossypium aridum] ref|YP_009341288.1| ribosomal protein S7 (chloroplast) [Gossypium trilobum] ref|YP_009341301.1| ribosomal protein S7 (chloroplast) [Gossypium trilobum] ref|YP_009341385.1| ribosomal protein S7 (chloroplast) [Gossypium populifolium] ref|YP_009341372.1| ribosomal protein S7 (chloroplast) [Gossypium populifolium] ref|YP_009341456.1| ribosomal protein S7 (chloroplast) [Gossypium nelsonii] ref|YP_009341469.1| ribosomal protein S7 (chloroplast) [Gossypium nelsonii] ref|YP_009341540.1| ribosomal protein S7 (chloroplast) [Gossypium armourianum] ref|YP_009341553.1| ribosomal protein S7 (chloroplast) [Gossypium armourianum] ref|YP_009341624.1| ribosomal protein S7 (chloroplast) [Gossypium australe] ref|YP_009341637.1| ribosomal protein S7 (chloroplast) [Gossypium australe] ref|YP_009342552.1| ribosomal protein S7 (chloroplast) [Orychophragmus diffusus] ref|YP_009342566.1| ribosomal protein S7 (chloroplast) [Orychophragmus diffusus] ref|YP_009342637.1| ribosomal protein S7 (chloroplast) [Orychophragmus taibaiensis] ref|YP_009342651.1| ribosomal protein S7 (chloroplast) [Orychophragmus taibaiensis] ref|YP_009342722.1| ribosomal protein S7 (chloroplast) [Orychophragmus hupehensis] ref|YP_009342736.1| ribosomal protein S7 (chloroplast) [Orychophragmus hupehensis] ref|YP_009353797.1| ribosomal protein S7 (chloroplast) [Alyssum desertorum] ref|YP_009353811.1| ribosomal protein S7 (chloroplast) [Alyssum desertorum] ref|YP_009355980.1| ribosomal protein S7 (chloroplast) [Megadenia pygmaea] ref|YP_009355996.1| ribosomal protein S7 (chloroplast) [Megadenia pygmaea] ref|YP_009356066.1| ribosomal protein S7 (chloroplast) [Matthiola incana] ref|YP_009356080.1| ribosomal protein S7 (chloroplast) [Matthiola incana] ref|YP_009356148.1| ribosomal protein S7 (chloroplast) [Solms-laubachia eurycarpa] ref|YP_009356159.1| ribosomal protein S7 (chloroplast) [Solms-laubachia eurycarpa] ref|YP_009356313.1| ribosomal protein S7 (chloroplast) [Neotorularia korolkowii] ref|YP_009356327.1| ribosomal protein S7 (chloroplast) [Neotorularia korolkowii] ref|YP_009356413.1| ribosomal protein S7 (chloroplast) [Thlaspi arvense] ref|YP_009356399.1| ribosomal protein S7 (chloroplast) [Thlaspi arvense] ref|YP_009356486.1| ribosomal protein S7 (chloroplast) [Lepidium meyenii] ref|YP_009356500.1| ribosomal protein S7 (chloroplast) [Lepidium meyenii] ref|YP_009356586.1| ribosomal protein S7 (chloroplast) [Tarenaya hassleriana] ref|YP_009356572.1| ribosomal protein S7 (chloroplast) [Tarenaya hassleriana] ref|YP_009356671.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata] ref|YP_009356657.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata] ref|YP_009356756.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri] ref|YP_009356742.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri] ref|YP_009356825.1| ribosomal protein S7 (chloroplast) [Aethionema arabicum] ref|YP_009356839.1| ribosomal protein S7 (chloroplast) [Aethionema arabicum] ref|YP_009357312.1| 30S ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. lyrata] ref|YP_009357326.1| 30S ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. lyrata] ref|YP_009366801.1| ribosomal protein S7 (plastid) [Althaea officinalis] ref|YP_009366814.1| ribosomal protein S7 (plastid) [Althaea officinalis] ref|YP_009390350.1| ribosomal protein S7 (chloroplast) [Abelmoschus esculentus] ref|YP_009390363.1| ribosomal protein S7 (chloroplast) [Abelmoschus esculentus] ref|YP_009400133.1| ribosomal protein S7 (chloroplast) [Sinapis arvensis] ref|YP_009400147.1| ribosomal protein S7 (chloroplast) [Sinapis arvensis] ref|YP_009409768.1| ribosomal protein S7 (chloroplast) [Morettia canescens] ref|YP_009409781.1| ribosomal protein S7 (chloroplast) [Morettia canescens] ref|YP_009409510.1| ribosomal protein S7 (chloroplast) [Hesperis matronalis] ref|YP_009409525.1| ribosomal protein S7 (chloroplast) [Hesperis matronalis] ref|YP_009409596.1| ribosomal protein S7 (chloroplast) [Hesperis sylvestris] ref|YP_009409610.1| ribosomal protein S7 (chloroplast) [Hesperis sylvestris] ref|YP_009409681.1| ribosomal protein S7 (chloroplast) [Lobularia libyca] ref|YP_009409695.1| ribosomal protein S7 (chloroplast) [Lobularia libyca] ref|YP_009409853.1| ribosomal protein S7 (chloroplast) [Braya humilis] ref|YP_009409866.1| ribosomal protein S7 (chloroplast) [Braya humilis] ref|YP_009428841.1| ribosomal protein S7 (chloroplast) [Decaisnea insignis] ref|YP_009428854.1| ribosomal protein S7 (chloroplast) [Decaisnea insignis] ref|YP_009438014.1| ribosomal protein S7 (chloroplast) [Bunias erucago] ref|YP_009438028.1| ribosomal protein S7 (chloroplast) [Bunias erucago] ref|YP_009438099.1| ribosomal protein S7 (chloroplast) [Bunias orientalis] ref|YP_009438113.1| ribosomal protein S7 (chloroplast) [Bunias orientalis] ref|YP_009444908.1| ribosomal protein S7 (chloroplast) [Firmiana pulcherrima] ref|YP_009444921.1| ribosomal protein S7 (chloroplast) [Firmiana pulcherrima] ref|YP_009460129.1| ribosomal protein S7 (chloroplast) [Tapiscia sinensis] ref|YP_009460142.1| ribosomal protein S7 (chloroplast) [Tapiscia sinensis] ref|YP_009460312.1| ribosomal protein S7 (plastid) [Cardamine amara] ref|YP_009460299.1| ribosomal protein S7 (plastid) [Cardamine amara] ref|YP_009460398.1| ribosomal protein S7 (plastid) [Cardamine oligosperma] ref|YP_009460384.1| ribosomal protein S7 (plastid) [Cardamine oligosperma] ref|YP_009460484.1| ribosomal protein S7 (plastid) [Cardamine parviflora] ref|YP_009460470.1| ribosomal protein S7 (plastid) [Cardamine parviflora] ref|YP_009471601.1| ribosomal protein S7 (chloroplast) [Firmiana major] ref|YP_009471588.1| ribosomal protein S7 (chloroplast) [Firmiana major] ref|XP_016719336.1| PREDICTED: 30S ribosomal protein S7, chloroplastic [Gossypium hirsutum] ref|XP_016719347.1| PREDICTED: 30S ribosomal protein S7, chloroplastic [Gossypium hirsutum] ref|XP_016719349.1| PREDICTED: 30S ribosomal protein S7, chloroplastic [Gossypium hirsutum] ref|XP_016719357.1| PREDICTED: 30S ribosomal protein S7, chloroplastic [Gossypium hirsutum] ref|XP_016719359.1| PREDICTED: 30S ribosomal protein S7, chloroplastic [Gossypium hirsutum] ref|XP_017622735.1| PREDICTED: 30S ribosomal protein S7, chloroplastic [Gossypium arboreum] ref|XP_017629393.1| PREDICTED: 30S ribosomal protein S7, chloroplastic [Gossypium arboreum] sp|P61841.1|RR7_ARATH RecName: Full=30S ribosomal protein S7, chloroplastic sp|P61842.1|RR7_BRANA RecName: Full=30S ribosomal protein S7, chloroplastic sp|Q2L964.1|RR7_GOSHI RecName: Full=30S ribosomal protein S7, chloroplastic sp|A0ZZ80.1|RR7_GOSBA RecName: Full=30S ribosomal protein S7, chloroplastic sp|A4QJG0.1|RR7_AETCO RecName: Full=30S ribosomal protein S7, chloroplastic sp|A4QJP4.1|RR7_AETGR RecName: Full=30S ribosomal protein S7, chloroplastic sp|A4QK64.1|RR7_ARAHI RecName: Full=30S ribosomal protein S7, chloroplastic sp|A4QKF1.1|RR7_BARVE RecName: Full=30S ribosomal protein S7, chloroplastic sp|A4QKN8.1|RR7_CAPBU RecName: Full=30S ribosomal protein S7, chloroplastic sp|B1A980.1|RR7_CARPA RecName: Full=30S ribosomal protein S7, chloroplastic sp|A4QKX7.1|RR7_CRUWA RecName: Full=30S ribosomal protein S7, chloroplastic sp|A4QL65.1|RR7_DRANE RecName: Full=30S ribosomal protein S7, chloroplastic sp|A4QLF2.1|RR7_LEPVR RecName: Full=30S ribosomal protein S7, chloroplastic sp|A4QLP0.1|RR7_LOBMA RecName: Full=30S ribosomal protein S7, chloroplastic sp|A4QLX9.1|RR7_NASOF RecName: Full=30S ribosomal protein S7, chloroplastic sp|A4QJX6.1|RR7_OLIPU RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAD27618.1|AF124376_1 30S ribosomal protein S7 (chloroplast) [Brassica napus] dbj|BAA84431.1| ribosomal protein S7 (chloroplast) [Arabidopsis thaliana] dbj|BAA84446.1| ribosomal protein S7 (chloroplast) [Arabidopsis thaliana] gb|AAQ14195.1| ribosomal protein S7 (chloroplast) [Arabidopsis thaliana] gb|AAQ64545.1| ribosomal protein S7 (chloroplast) [Euptelea polyandra] gb|AAN32037.1| ribosomal protein S7 (chloroplast) [Molineria capitulata] gb|ABC73672.1| ribosomal protein S7 (chloroplast) [Gossypium hirsutum] gb|ABC73687.1| ribosomal protein S7 (chloroplast) [Gossypium hirsutum] dbj|BAF41292.1| Ribosomal protein S7 (chloroplast) [Gossypium barbadense] dbj|BAF41306.1| Ribosomal protein S7 (chloroplast) [Gossypium barbadense] dbj|BAF49815.1| ribosomal protein S7 (chloroplast) [Aethionema cordifolium] dbj|BAF49830.1| ribosomal protein S7 (chloroplast) [Aethionema cordifolium] dbj|BAF49899.1| ribosomal protein S7 (chloroplast) [Aethionema grandiflorum] dbj|BAF49914.1| ribosomal protein S7 (chloroplast) [Aethionema grandiflorum] dbj|BAF49984.1| ribosomal protein S7 (chloroplast) [Olimarabidopsis pumila] dbj|BAF49999.1| ribosomal protein S7 (chloroplast) [Olimarabidopsis pumila] dbj|BAF50069.1| ribosomal protein S7 (chloroplast) [Arabis hirsuta] dbj|BAF50084.1| ribosomal protein S7 (chloroplast) [Arabis hirsuta] dbj|BAF50156.1| ribosomal protein S7 (chloroplast) [Barbarea verna] dbj|BAF50171.1| ribosomal protein S7 (chloroplast) [Barbarea verna] dbj|BAF50243.1| ribosomal protein S7 (chloroplast) [Capsella bursa-pastoris] dbj|BAF50260.1| ribosomal protein S7 (chloroplast) [Capsella bursa-pastoris] dbj|BAF50332.1| ribosomal protein S7 (chloroplast) [Crucihimalaya wallichii] dbj|BAF50349.1| ribosomal protein S7 (chloroplast) [Crucihimalaya wallichii] dbj|BAF50420.1| ribosomal protein S7 (chloroplast) [Draba nemorosa] dbj|BAF50435.1| ribosomal protein S7 (chloroplast) [Draba nemorosa] dbj|BAF50507.1| ribosomal protein S7 (chloroplast) [Lepidium virginicum] dbj|BAF50524.1| ribosomal protein S7 (chloroplast) [Lepidium virginicum] dbj|BAF50595.1| ribosomal protein S7 (chloroplast) [Lobularia maritima] dbj|BAF50612.1| ribosomal protein S7 (chloroplast) [Lobularia maritima] dbj|BAF50684.1| ribosomal protein S7 (chloroplast) [Nasturtium officinale] dbj|BAF50699.1| ribosomal protein S7 (chloroplast) [Nasturtium officinale] gb|ABY86828.1| ribosomal protein S7 (chloroplast) [Carica papaya] gb|ABY86841.1| ribosomal protein S7 (chloroplast) [Carica papaya] gb|ACY66241.1| ribosomal protein S7 (chloroplast) [Brassica napus] gb|ACY66294.1| ribosomal protein S7 (chloroplast) [Brassica napus] gb|ADD62329.1| ribosomal protein S7 (chloroplast) [Gossypium thurberi] gb|ADD62346.1| ribosomal protein S7 (chloroplast) [Gossypium thurberi] gb|EFH64652.1| ribosomal protein S7 [Arabidopsis lyrata subsp. lyrata] gb|EFH67492.1| ribosomal protein S7 [Arabidopsis lyrata subsp. lyrata] gb|ADO64853.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|ADO64866.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|ADV38835.1| ribosomal protein S7 (chloroplast) [Gossypium arboreum] gb|ADV38846.1| ribosomal protein S7 (chloroplast) [Gossypium arboreum] gb|ADV38916.1| ribosomal protein S7 (chloroplast) [Gossypium darwinii] gb|ADV38928.1| ribosomal protein S7 (chloroplast) [Gossypium darwinii] gb|ADV39001.1| ribosomal protein S7 (chloroplast) [Gossypium herbaceum subsp. africanum] gb|ADV39014.1| ribosomal protein S7 (chloroplast) [Gossypium herbaceum subsp. africanum] gb|ADV39084.1| ribosomal protein S7 (chloroplast) [Gossypium mustelinum] gb|ADV39095.1| ribosomal protein S7 (chloroplast) [Gossypium mustelinum] gb|ADV39162.1| ribosomal protein S7 (chloroplast) [Gossypium raimondii] gb|ADV39172.1| ribosomal protein S7 (chloroplast) [Gossypium raimondii] gb|ADV39250.1| ribosomal protein S7 (chloroplast) [Gossypium tomentosum] gb|ADV39263.1| ribosomal protein S7 (chloroplast) [Gossypium tomentosum] gb|ADZ74347.1| ribosomal protein S7 (chloroplast) [Gossypium anomalum] gb|ADZ74367.1| ribosomal protein S7 (chloroplast) [Gossypium anomalum] gb|ADZ74435.1| ribosomal protein S7 (chloroplast) [Gossypium bickii] gb|ADZ74454.1| ribosomal protein S7 (chloroplast) [Gossypium bickii] gb|ADZ74523.1| ribosomal protein S7 (chloroplast) [Gossypium herbaceum] gb|ADZ74539.1| ribosomal protein S7 (chloroplast) [Gossypium herbaceum] gb|ADZ74606.1| ribosomal protein S7 (chloroplast) [Gossypium longicalyx] gb|ADZ74624.1| ribosomal protein S7 (chloroplast) [Gossypium longicalyx] gb|ADZ74694.1| ribosomal protein S7 (chloroplast) [Gossypium stocksii] gb|ADZ74711.1| ribosomal protein S7 (chloroplast) [Gossypium stocksii] gb|ADZ74781.1| ribosomal protein S7 (chloroplast) [Gossypium sturtianum] gb|ADZ74799.1| ribosomal protein S7 (chloroplast) [Gossypium sturtianum] gb|ADO64935.2| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|ADO64949.2| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEB90473.1| ribosomal protein S7 (chloroplast) [Gossypium gossypioides] gb|AEB90485.1| ribosomal protein S7 (chloroplast) [Gossypium gossypioides] gb|AEB90556.1| ribosomal protein S7 (chloroplast) [Gossypium hirsutum] gb|AEB90568.1| ribosomal protein S7 (chloroplast) [Gossypium hirsutum] gb|AEB90639.1| ribosomal protein S7 (chloroplast) [Gossypium hirsutum] gb|AEB90651.1| ribosomal protein S7 (chloroplast) [Gossypium hirsutum] gb|AEB90722.1| ribosomal protein S7 (chloroplast) [Gossypium barbadense] gb|AEB90734.1| ribosomal protein S7 (chloroplast) [Gossypium barbadense] gb|AEB90805.1| ribosomal protein S7 (chloroplast) [Gossypium barbadense] gb|AEB90817.1| ribosomal protein S7 (chloroplast) [Gossypium barbadense] gb|AEB90888.1| ribosomal protein S7 (chloroplast) [Gossypium barbadense] gb|AEB90900.1| ribosomal protein S7 (chloroplast) [Gossypium barbadense] gb|AEH42994.1| ribosomal protein S7 (chloroplast) [Gossypium incanum] gb|AEH43006.1| ribosomal protein S7 (chloroplast) [Gossypium incanum] gb|AEH43077.1| ribosomal protein S7 (chloroplast) [Gossypium somalense] gb|AEH43089.1| ribosomal protein S7 (chloroplast) [Gossypium somalense] gb|AEH43160.1| ribosomal protein S7 (chloroplast) [Gossypium capitis-viridis] gb|AEH43172.1| ribosomal protein S7 (chloroplast) [Gossypium capitis-viridis] gb|AEH43243.1| ribosomal protein S7 (chloroplast) [Gossypium areysianum] gb|AEH43255.1| ribosomal protein S7 (chloroplast) [Gossypium areysianum] gb|AEH43326.1| ribosomal protein S7 (chloroplast) [Gossypium robinsonii] gb|AEH43338.1| ribosomal protein S7 (chloroplast) [Gossypium robinsonii] gb|AEX57770.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX57783.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX57851.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX57864.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX57932.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX57945.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58013.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58026.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58094.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58107.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58175.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58188.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58256.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58269.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58337.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58350.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58418.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58431.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58499.1| ribosomal protein S7 (chloroplast) [Theobroma grandiflorum] gb|AEX58512.1| ribosomal protein S7 (chloroplast) [Theobroma grandiflorum] gb|AEX58580.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AEX58593.1| ribosomal protein S7 (chloroplast) [Theobroma cacao] gb|AFG25686.1| ribosomal protein S7 (plastid) [Molineria capitulata] gb|AFH57617.1| ribosomal protein S7 (chloroplast) [Gossypium turneri] gb|AFH57637.1| ribosomal protein S7 (chloroplast) [Gossypium turneri] gb|AFM92325.1| ribosomal protein S7 (chloroplast) [Pachycladon cheesemanii] gb|AFM92339.1| ribosomal protein S7 (chloroplast) [Pachycladon cheesemanii] gb|AFQ07837.1| ribosomal protein S7 (chloroplast) [Pachycladon enysii] gb|AFQ07851.1| ribosomal protein S7 (chloroplast) [Pachycladon enysii] gb|ESQ30845.1| hypothetical protein EUTSA_v10011843mg [Eutrema salsugineum] emb|CCW28226.1| rps7 protein (chloroplast) [Arabis alpina] emb|CCW28240.1| rps7 protein (chloroplast) [Arabis alpina] gb|AHH80684.1| ribosomal protein S7 (plastid) [Gossypium laxum] gb|AHI87574.1| 30S ribosomal protein S7 (chloroplast) [Chionographis japonica] gb|AHI87587.1| 30S ribosomal protein S7 (chloroplast) [Chionographis japonica] gb|AHN07215.1| ribosomal protein S7 (plastid) [Cardamine impatiens] gb|AHN07229.1| ribosomal protein S7 (plastid) [Cardamine impatiens] gb|AHN07300.1| ribosomal protein S7 (plastid) [Cardamine resedifolia] gb|AHN07314.1| ribosomal protein S7 (plastid) [Cardamine resedifolia] emb|CDP55214.1| SSU ribosomal protein S7p (S5e) [Staphylococcus aureus subsp. aureus] gb|AIE42513.1| ribosomal protein S7 (chloroplast) [Raphanus sativus] gb|AIE42527.1| ribosomal protein S7 (chloroplast) [Raphanus sativus] gb|AIK29050.1| ribosomal protein S7 (chloroplast) [Brassica napus] gb|AIK29064.1| ribosomal protein S7 (chloroplast) [Brassica napus] emb|CDY45545.1| BnaCnng13040D [Brassica napus] emb|CDY19673.1| BnaC09g29290D [Brassica napus] gb|AIW56550.1| 30S ribosomal protein S7 (chloroplast) [Heloniopsis tubiflora] gb|AIW56563.1| 30S ribosomal protein S7 (chloroplast) [Heloniopsis tubiflora] gb|AIZ06126.1| ribosomal protein S7 (chloroplast) [Brassica napus] gb|AIZ06140.1| ribosomal protein S7 (chloroplast) [Brassica napus] gb|AJC09102.1| ribosomal protein S7 (chloroplast) [Hibiscus syriacus] gb|AJC09115.1| ribosomal protein S7 (chloroplast) [Hibiscus syriacus] gb|AJD79976.1| ribosomal protein S7 (chloroplast) [Gossypium klotzschianum] gb|AJD79992.1| ribosomal protein S7 (chloroplast) [Gossypium klotzschianum] gb|AJD80060.1| ribosomal protein S7 (chloroplast) [Gossypium davidsonii] gb|AJD80074.1| ribosomal protein S7 (chloroplast) [Gossypium davidsonii] gb|AJD80145.1| ribosomal protein S7 (chloroplast) [Gossypium aridum] gb|AJD80160.1| ribosomal protein S7 (chloroplast) [Gossypium aridum] gb|AJD80229.1| ribosomal protein S7 (chloroplast) [Gossypium trilobum] gb|AJD80245.1| ribosomal protein S7 (chloroplast) [Gossypium trilobum] gb|AJE75306.1| ribosomal protein S7 (chloroplast) [Gossypium populifolium] gb|AJE75322.1| ribosomal protein S7 (chloroplast) [Gossypium populifolium] gb|AJE75390.1| ribosomal protein S7 (chloroplast) [Gossypium nelsonii] gb|AJE75406.1| ribosomal protein S7 (chloroplast) [Gossypium nelsonii] gb|AJE75474.1| ribosomal protein S7 (chloroplast) [Gossypium armourianum] gb|AJE75490.1| ribosomal protein S7 (chloroplast) [Gossypium armourianum] gb|AJE75558.1| ribosomal protein S7 (chloroplast) [Gossypium harknessii] gb|AJE75574.1| ribosomal protein S7 (chloroplast) [Gossypium harknessii] gb|AJE75642.1| ribosomal protein S7 (chloroplast) [Gossypium australe] gb|AJE75658.1| ribosomal protein S7 (chloroplast) [Gossypium australe] gb|AKA94903.1| ribosomal protein S7 (chloroplast) [Hibiscus syriacus] gb|AKD00135.1| ribosomal protein S7 (plastid) [Brassica napus] gb|AKD00149.1| ribosomal protein S7 (plastid) [Brassica napus] gb|AKM97963.1| ribosomal protein S7 (chloroplast) [Brassica oleracea var. capitata] gb|AKM97979.1| ribosomal protein S7 (chloroplast) [Brassica oleracea var. capitata] gb|AKS28816.1| ribosomal protein S7 (chloroplast) [Capsella rubella] gb|AKS28829.1| ribosomal protein S7 (chloroplast) [Capsella rubella] gb|AKU47295.1| ribosomal protein S7 (chloroplast) [Capsella grandiflora] gb|AKU47309.1| ribosomal protein S7 (chloroplast) [Capsella grandiflora] gb|ALH16876.1| ribosomal protein S7 (chloroplast) [Eutrema salsugineum] gb|ALH16893.1| ribosomal protein S7 (chloroplast) [Eutrema salsugineum] gb|ALI86796.1| ribosomal protein S7 (chloroplast) [Talipariti hamabo] gb|ALI86815.1| ribosomal protein S7 (chloroplast) [Talipariti hamabo] gb|ALI86882.1| ribosomal protein S7 (chloroplast) [Hibiscus syriacus] gb|ALI86895.1| ribosomal protein S7 (chloroplast) [Hibiscus syriacus] gb|ALK26729.1| ribosomal protein S7 (chloroplast) [Brassica juncea] gb|ALK26742.1| ribosomal protein S7 (chloroplast) [Brassica juncea] gb|ALL45429.1| ribosomal protein S7 (chloroplast) [Isatis tinctoria] gb|ALL45430.1| ribosomal protein S7 (chloroplast) [Isatis tinctoria] gb|ALO63709.1| ribosomal protein S7 (plastid) [Tilia amurensis] gb|ALO63722.1| ribosomal protein S7 (plastid) [Tilia amurensis] gb|ALO63794.1| ribosomal protein S7 (plastid) [Tilia mandshurica] gb|ALO63807.1| ribosomal protein S7 (plastid) [Tilia mandshurica] gb|ALO63879.1| ribosomal protein S7 (plastid) [Tilia oliveri] gb|ALO63892.1| ribosomal protein S7 (plastid) [Tilia oliveri] gb|ALO63964.1| ribosomal protein S7 (plastid) [Tilia paucicostata] gb|ALO63977.1| ribosomal protein S7 (plastid) [Tilia paucicostata] gb|ALP73154.1| ribosomal protein S7 (chloroplast) [Schrenkiella parvula] gb|ALP73171.1| ribosomal protein S7 (chloroplast) [Schrenkiella parvula] gb|ALP73250.1| ribosomal protein S7 (chloroplast) [Eutrema yunnanense] gb|ALP73259.1| ribosomal protein S7 (chloroplast) [Eutrema yunnanense] gb|ALP73328.1| ribosomal protein S7 (chloroplast) [Eutrema heterophyllum] gb|ALP73345.1| ribosomal protein S7 (chloroplast) [Eutrema heterophyllum] emb|CRN13183.1| ribosomal protein S7 (chloroplast) [Cochlearia borzaeana] emb|CRN13197.1| ribosomal protein S7 (chloroplast) [Cochlearia borzaeana] emb|CRN13266.1| ribosomal protein S7 (chloroplast) [Cochlearia islandica] emb|CRN13280.1| ribosomal protein S7 (chloroplast) [Cochlearia islandica] emb|CRN13349.1| ribosomal protein S7 (chloroplast) [Cochlearia pyrenaica] emb|CRN13363.1| ribosomal protein S7 (chloroplast) [Cochlearia pyrenaica] emb|CRN13432.1| ribosomal protein S7 (chloroplast) [Cochlearia tridactylites] emb|CRN13446.1| ribosomal protein S7 (chloroplast) [Cochlearia tridactylites] emb|CRN13515.1| ribosomal protein S7 (chloroplast) [Ionopsidium acaule] emb|CRN13529.1| ribosomal protein S7 (chloroplast) [Ionopsidium acaule] emb|CUA65195.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CUA65209.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CUA65280.1| ribosomal protein S7 (chloroplast) [Arabidopsis cebennensis] emb|CUA65294.1| ribosomal protein S7 (chloroplast) [Arabidopsis cebennensis] emb|CUA65365.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. halleri] emb|CUA65379.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. halleri] emb|CUA65450.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. lyrata] emb|CUA65464.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. lyrata] emb|CUA65535.1| ribosomal protein S7 (chloroplast) [Arabidopsis pedemontana] emb|CUA65549.1| ribosomal protein S7 (chloroplast) [Arabidopsis pedemontana] emb|CUA65620.1| ribosomal protein S7 (chloroplast) [Capsella rubella] emb|CUA65634.1| ribosomal protein S7 (chloroplast) [Capsella rubella] emb|CUA65704.1| ribosomal protein S7 (chloroplast) [Camelina sativa] emb|CUA65718.1| ribosomal protein S7 (chloroplast) [Camelina sativa] gb|ALZ50151.1| ribosomal protein S7 (chloroplast) [Coreanomecon hylomeconoides] gb|ALZ50164.1| ribosomal protein S7 (chloroplast) [Coreanomecon hylomeconoides] gb|AMA21389.1| ribosomal protein S7 (chloroplast) [Eutrema halophilum] gb|AMA21403.1| ribosomal protein S7 (chloroplast) [Eutrema halophilum] gb|AMA21476.1| ribosomal protein S7 (chloroplast) [Eutrema botschantzevii] gb|AMA21490.1| ribosomal protein S7 (chloroplast) [Eutrema botschantzevii] gb|AMC32654.1| ribosomal protein S7 (chloroplast) [Callirhoe involucrata] gb|AMC32656.1| ribosomal protein S7 (chloroplast) [Capsella bursa-pastoris] gb|AMC32666.1| ribosomal protein S7 (chloroplast) [Lepidium densiflorum] gb|AMC32672.1| ribosomal protein S7 (chloroplast) [Physaria ludoviciana] gb|AMD08319.1| ribosomal protein S7 (chloroplast) [Euptelea pleiosperma] gb|AMD08332.1| ribosomal protein S7 (chloroplast) [Euptelea pleiosperma] gb|AMD08573.1| ribosomal protein S7 (chloroplast) [Stephania japonica] gb|AMD08586.1| ribosomal protein S7 (chloroplast) [Stephania japonica] gb|AMD08746.1| ribosomal protein S7 (chloroplast) [Papaver somniferum] gb|AMD08759.1| ribosomal protein S7 (chloroplast) [Papaver somniferum] gb|AMK97152.1| ribosomal protein S7 (chloroplast) [Pachycladon fastigiatum] gb|AMK97165.1| ribosomal protein S7 (chloroplast) [Pachycladon fastigiatum] gb|ANE10955.1| ribosomal protein S7 (chloroplast) [Brassica nigra] gb|ANE10969.1| ribosomal protein S7 (chloroplast) [Brassica nigra] gb|ANH20915.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. gemmifera] gb|ANH20928.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. gemmifera] gb|ANH21001.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] gb|ANH21014.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF87622.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenicola] emb|CZF87636.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenicola] emb|CZF87707.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenicola] emb|CZF87721.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenicola] emb|CZF87792.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenicola] emb|CZF87806.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenicola] emb|CZF87962.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF87976.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88047.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88061.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88132.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88146.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88217.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88231.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88302.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88316.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88387.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88401.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88472.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88486.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88557.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88571.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88642.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88656.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88727.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88741.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88812.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88826.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88897.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88911.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88982.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF88996.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89067.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89081.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89152.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89166.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89237.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89251.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89322.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89336.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89407.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89421.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89492.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89506.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89577.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89591.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89662.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89676.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89747.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89761.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF89832.1| ribosomal protein S7 (chloroplast) [Arabidopsis cebennensis] emb|CZF89846.1| ribosomal protein S7 (chloroplast) [Arabidopsis cebennensis] emb|CZF89917.1| ribosomal protein S7 (chloroplast) [Arabidopsis cebennensis] emb|CZF89931.1| ribosomal protein S7 (chloroplast) [Arabidopsis cebennensis] emb|CZF90002.1| ribosomal protein S7 (chloroplast) [Arabidopsis croatica] emb|CZF90016.1| ribosomal protein S7 (chloroplast) [Arabidopsis croatica] emb|CZF90087.1| ribosomal protein S7 (chloroplast) [Arabidopsis croatica] emb|CZF90101.1| ribosomal protein S7 (chloroplast) [Arabidopsis croatica] emb|CZF90172.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. dacica] emb|CZF90186.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. dacica] emb|CZF90257.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. gemmifera] emb|CZF90271.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. gemmifera] emb|CZF90342.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. gemmifera] emb|CZF90356.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. gemmifera] emb|CZF90427.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. halleri] emb|CZF90441.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. halleri] emb|CZF90512.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. halleri] emb|CZF90526.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. halleri] emb|CZF90597.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. ovirensis] emb|CZF90611.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. ovirensis] emb|CZF90682.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. ovirensis] emb|CZF90696.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. ovirensis] emb|CZF90767.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. tatrica] emb|CZF90781.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. tatrica] emb|CZF90852.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. tatrica] emb|CZF90866.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri subsp. tatrica] emb|CZF90937.1| ribosomal protein S7 (chloroplast) [Arabidopsis kamchatica subsp. kamchatica] emb|CZF90951.1| ribosomal protein S7 (chloroplast) [Arabidopsis kamchatica subsp. kamchatica] emb|CZF91022.1| ribosomal protein S7 (chloroplast) [Arabidopsis kamchatica subsp. kamchatica] emb|CZF91036.1| ribosomal protein S7 (chloroplast) [Arabidopsis kamchatica subsp. kamchatica] emb|CZF91107.1| ribosomal protein S7 (chloroplast) [Arabidopsis kamchatica subsp. kamchatica] emb|CZF91121.1| ribosomal protein S7 (chloroplast) [Arabidopsis kamchatica subsp. kamchatica] emb|CZF91192.1| ribosomal protein S7 (chloroplast) [Arabidopsis kamchatica subsp. kawasakiana] emb|CZF91206.1| ribosomal protein S7 (chloroplast) [Arabidopsis kamchatica subsp. kawasakiana] emb|CZF91277.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. lyrata] emb|CZF91291.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. lyrata] emb|CZF91362.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91376.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91447.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91461.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91532.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91546.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91617.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91631.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91702.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91716.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91787.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91801.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91872.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91886.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91957.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF91971.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92042.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92056.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92127.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92141.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92212.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92226.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92297.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92311.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92382.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92396.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92467.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92481.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92552.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92566.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92637.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92651.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92722.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92736.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92807.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92821.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92892.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92906.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92977.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF92991.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF93062.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF93076.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. petraea] emb|CZF93147.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta subsp. neglecta] emb|CZF93161.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta subsp. neglecta] emb|CZF93232.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta subsp. neglecta] emb|CZF93246.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta subsp. neglecta] emb|CZF93317.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta subsp. neglecta] emb|CZF93331.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta subsp. neglecta] emb|CZF93402.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta subsp. neglecta] emb|CZF93416.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta subsp. neglecta] emb|CZF93487.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta] emb|CZF93501.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta] emb|CZF93572.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta] emb|CZF93586.1| ribosomal protein S7 (chloroplast) [Arabidopsis neglecta] emb|CZF93657.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF93671.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF93742.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF93756.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF93827.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF93841.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF93912.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF93926.1| ribosomal protein S7 (chloroplast) [Arabidopsis arenosa] emb|CZF93997.1| ribosomal protein S7 (chloroplast) [Arabidopsis pedemontana] emb|CZF94011.1| ribosomal protein S7 (chloroplast) [Arabidopsis pedemontana] emb|CZF94082.1| ribosomal protein S7 (chloroplast) [Arabidopsis petraea subsp. septentrionalis] emb|CZF94096.1| ribosomal protein S7 (chloroplast) [Arabidopsis petraea subsp. septentrionalis] emb|CZF94167.1| ribosomal protein S7 (chloroplast) [Arabidopsis petraea subsp. septentrionalis] emb|CZF94181.1| ribosomal protein S7 (chloroplast) [Arabidopsis petraea subsp. septentrionalis] emb|CZF94252.1| ribosomal protein S7 (chloroplast) [Arabidopsis petraea subsp. umbrosa] emb|CZF94266.1| ribosomal protein S7 (chloroplast) [Arabidopsis petraea subsp. umbrosa] emb|CZF94337.1| ribosomal protein S7 (chloroplast) [Arabidopsis petraea subsp. umbrosa] emb|CZF94351.1| ribosomal protein S7 (chloroplast) [Arabidopsis petraea subsp. umbrosa] emb|CZF94422.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] emb|CZF94436.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] emb|CZF94507.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] emb|CZF94521.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] emb|CZF94592.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] emb|CZF94606.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] emb|CZF94677.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] emb|CZF94691.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] emb|CZF94762.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] emb|CZF94776.1| ribosomal protein S7 (chloroplast) [Arabidopsis petrogena] emb|CZF94847.1| ribosomal protein S7 (chloroplast) [Arabidopsis suecica] emb|CZF94861.1| ribosomal protein S7 (chloroplast) [Arabidopsis suecica] emb|CZF94932.1| ribosomal protein S7 (chloroplast) [Arabidopsis suecica] emb|CZF94946.1| ribosomal protein S7 (chloroplast) [Arabidopsis suecica] emb|CZF95017.1| ribosomal protein S7 (chloroplast) [Arabidopsis suecica] emb|CZF95031.1| ribosomal protein S7 (chloroplast) [Arabidopsis suecica] emb|CZF95102.1| ribosomal protein S7 (chloroplast) [Arabidopsis umezawana] emb|CZF95116.1| ribosomal protein S7 (chloroplast) [Arabidopsis umezawana] gb|ANJ04088.1| ribosomal protein S7 (chloroplast) [Pugionium dolabratum] gb|ANJ04102.1| ribosomal protein S7 (chloroplast) [Pugionium dolabratum] gb|ANJ04173.1| ribosomal protein S7 (chloroplast) [Pugionium cornutum] gb|ANJ04187.1| ribosomal protein S7 (chloroplast) [Pugionium cornutum] gb|ANK36756.1| ribosomal protein S7 (chloroplast) [Sinapis arvensis] gb|ANK36769.1| ribosomal protein S7 (chloroplast) [Sinapis arvensis] gb|ANW47835.1| ribosomal protein S7 (chloroplast) [Arabidopsis thaliana] gb|ANW47849.1| ribosomal protein S7 (chloroplast) [Arabidopsis thaliana] gb|ANW83324.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83338.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83410.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83424.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83495.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83509.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83581.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83595.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83668.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83682.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83756.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83768.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83842.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83854.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83928.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW83940.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW84014.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANW84026.1| ribosomal protein S7 (plastid) [Brassica napus var. napus] gb|ANX10093.1| ribosomal protein S7 (chloroplast) [Cakile arabica] gb|ANX10108.1| ribosomal protein S7 (chloroplast) [Cakile arabica] gb|ANY60235.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata] gb|ANY60249.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata] dbj|BAW03031.1| 30S ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. lyrata] dbj|BAW03046.1| 30S ribosomal protein S7 (chloroplast) [Arabidopsis lyrata subsp. lyrata] gb|APO08571.1| ribosomal protein S7 (chloroplast) [Orychophragmus violaceus] gb|APO08585.1| ribosomal protein S7 (chloroplast) [Orychophragmus violaceus] gb|APO09304.1| ribosomal protein S7 (chloroplast) [Megadenia pygmaea] gb|APO09320.1| ribosomal protein S7 (chloroplast) [Megadenia pygmaea] gb|APS85126.1| ribosomal protein S7 (chloroplast) [Orychophragmus sp. HH-2017b] gb|APS85140.1| ribosomal protein S7 (chloroplast) [Orychophragmus sp. HH-2017b] gb|APS85211.1| ribosomal protein S7 (chloroplast) [Orychophragmus diffusus] gb|APS85225.1| ribosomal protein S7 (chloroplast) [Orychophragmus diffusus] gb|APS85296.1| ribosomal protein S7 (chloroplast) [Orychophragmus sp. HH-2017a] gb|APS85310.1| ribosomal protein S7 (chloroplast) [Orychophragmus sp. HH-2017a] gb|APS85381.1| ribosomal protein S7 (chloroplast) [Orychophragmus taibaiensis] gb|APS85395.1| ribosomal protein S7 (chloroplast) [Orychophragmus taibaiensis] gb|APS85466.1| ribosomal protein S7 (chloroplast) [Orychophragmus hupehensis] gb|APS85480.1| ribosomal protein S7 (chloroplast) [Orychophragmus hupehensis] gb|AQV10145.1| ribosomal protein S7 (chloroplast) [Matthiola incana] gb|AQV10159.1| ribosomal protein S7 (chloroplast) [Matthiola incana] gb|AQV10227.1| ribosomal protein S7 (chloroplast) [Solms-laubachia eurycarpa] gb|AQV10238.1| ribosomal protein S7 (chloroplast) [Solms-laubachia eurycarpa] gb|AQV10392.1| ribosomal protein S7 (chloroplast) [Neotorularia korolkowii] gb|AQV10406.1| ribosomal protein S7 (chloroplast) [Neotorularia korolkowii] gb|AQV10475.1| ribosomal protein S7 (chloroplast) [Thlaspi arvense] gb|AQV10493.1| ribosomal protein S7 (chloroplast) [Thlaspi arvense] gb|AQV10563.1| ribosomal protein S7 (chloroplast) [Camelina sativa] gb|AQV10578.1| ribosomal protein S7 (chloroplast) [Camelina sativa] gb|AQV10648.1| ribosomal protein S7 (chloroplast) [Lepidium meyenii] gb|AQV10662.1| ribosomal protein S7 (chloroplast) [Lepidium meyenii] gb|AQV10736.1| ribosomal protein S7 (chloroplast) [Tarenaya hassleriana] gb|AQV10737.1| ribosomal protein S7 (chloroplast) [Tarenaya hassleriana] gb|AQV10820.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata] gb|AQV10835.1| ribosomal protein S7 (chloroplast) [Arabidopsis lyrata] gb|AQV10905.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri] gb|AQV10920.1| ribosomal protein S7 (chloroplast) [Arabidopsis halleri] gb|AQV10988.1| ribosomal protein S7 (chloroplast) [Aethionema arabicum] gb|AQV11002.1| ribosomal protein S7 (chloroplast) [Aethionema arabicum] gb|AQZ25151.1| ribosomal protein S7 (chloroplast) [Alyssum desertorum] gb|AQZ25152.1| ribosomal protein S7 (chloroplast) [Alyssum desertorum] gb|ARI44137.1| ribosomal protein S7 (chloroplast) [Lepidium meyenii] gb|ARI44138.1| ribosomal protein S7 (chloroplast) [Lepidium meyenii] gb|ARI46781.1| ribosomal protein S7 (chloroplast) [Arabis stelleri subsp. japonica] gb|ARI46795.1| ribosomal protein S7 (chloroplast) [Arabis stelleri subsp. japonica] gb|ARJ62230.1| ribosomal protein S7 (plastid) [Theobroma cacao] gb|ARJ62231.1| ribosomal protein S7 (plastid) [Theobroma cacao] gb|ARJ62809.1| ribosomal protein S7 (plastid) [Althaea officinalis] gb|ARJ62810.1| ribosomal protein S7 (plastid) [Althaea officinalis] gb|ARV86729.1| ribosomal protein S7 (chloroplast) [Abelmoschus esculentus] gb|ARV86742.1| ribosomal protein S7 (chloroplast) [Abelmoschus esculentus] gb|ARX79368.1| ribosomal protein S7 (chloroplast) [Decaisnea insignis] gb|ARX79381.1| ribosomal protein S7 (chloroplast) [Decaisnea insignis] gb|ASJ64086.1| ribosomal protein S7 (chloroplast) [Anastatica hierochuntica] gb|ASJ64099.1| ribosomal protein S7 (chloroplast) [Anastatica hierochuntica] gb|ASJ64170.1| ribosomal protein S7 (chloroplast) [Bunias orientalis] gb|ASJ64185.1| ribosomal protein S7 (chloroplast) [Bunias orientalis] gb|ASJ64257.1| ribosomal protein S7 (chloroplast) [Dontostemon micranthus] gb|ASJ64272.1| ribosomal protein S7 (chloroplast) [Dontostemon micranthus] gb|ASJ64342.1| ribosomal protein S7 (chloroplast) [Euclidium syriacum] gb|ASJ64356.1| ribosomal protein S7 (chloroplast) [Euclidium syriacum] gb|ASJ64426.1| ribosomal protein S7 (chloroplast) [Farsetia stylosa] gb|ASJ64441.1| ribosomal protein S7 (chloroplast) [Farsetia stylosa] gb|ASJ64513.1| ribosomal protein S7 (chloroplast) [Hesperis matronalis] gb|ASJ64528.1| ribosomal protein S7 (chloroplast) [Hesperis matronalis] gb|ASJ64599.1| ribosomal protein S7 (chloroplast) [Hesperis sylvestris] gb|ASJ64613.1| ribosomal protein S7 (chloroplast) [Hesperis sylvestris] gb|ASJ64762.1| ribosomal protein S7 (chloroplast) [Lobularia libyca] gb|ASJ64776.1| ribosomal protein S7 (chloroplast) [Lobularia libyca] gb|ASJ64847.1| ribosomal protein S7 (chloroplast) [Matthiola incana] gb|ASJ64861.1| ribosomal protein S7 (chloroplast) [Matthiola incana] gb|ASJ64933.1| ribosomal protein S7 (chloroplast) [Morettia canescens] gb|ASJ64946.1| ribosomal protein S7 (chloroplast) [Morettia canescens] gb|ASJ65018.1| ribosomal protein S7 (chloroplast) [Braya humilis] gb|ASJ65031.1| ribosomal protein S7 (chloroplast) [Braya humilis] gb|ASM41972.1| ribosomal protein S7 (chloroplast) [Alyssum montanum subsp. gmelinii] gb|ASM41985.1| ribosomal protein S7 (chloroplast) [Alyssum montanum subsp. gmelinii] gb|ASY93407.1| ribosomal protein S7 (chloroplast) [Brassica rapa] gb|ASY93422.1| ribosomal protein S7 (chloroplast) [Brassica rapa] gb|ASY93494.1| ribosomal protein S7 (chloroplast) [Brassica rapa subsp. chinensis] gb|ASY93509.1| ribosomal protein S7 (chloroplast) [Brassica rapa subsp. chinensis] gb|ASY93581.1| ribosomal protein S7 (chloroplast) [Brassica rapa subsp. pekinensis] gb|ASY93596.1| ribosomal protein S7 (chloroplast) [Brassica rapa subsp. pekinensis] gb|ASY93668.1| ribosomal protein S7 (chloroplast) [Brassica rapa subsp. rapa] gb|ASY93683.1| ribosomal protein S7 (chloroplast) [Brassica rapa subsp. rapa] gb|ASY93755.1| ribosomal protein S7 (chloroplast) [Brassica nigra] gb|ASY93770.1| ribosomal protein S7 (chloroplast) [Brassica nigra] gb|ASY93842.1| ribosomal protein S7 (chloroplast) [Brassica nigra] gb|ASY93857.1| ribosomal protein S7 (chloroplast) [Brassica nigra] gb|ASY93929.1| ribosomal protein S7 (chloroplast) [Brassica nigra] gb|ASY93944.1| ribosomal protein S7 (chloroplast) [Brassica nigra] gb|ASY94016.1| ribosomal protein S7 (chloroplast) [Brassica oleracea var. capitata] gb|ASY94031.1| ribosomal protein S7 (chloroplast) [Brassica oleracea var. capitata] gb|ASY94103.1| ribosomal protein S7 (chloroplast) [Brassica oleracea var. botrytis] gb|ASY94118.1| ribosomal protein S7 (chloroplast) [Brassica oleracea var. botrytis] gb|ASY94190.1| ribosomal protein S7 (chloroplast) [Brassica oleracea var. gongylodes] gb|ASY94205.1| ribosomal protein S7 (chloroplast) [Brassica oleracea var. gongylodes] gb|ASY94277.1| ribosomal protein S7 (chloroplast) [Brassica oleracea var. italica] gb|ASY94292.1| ribosomal protein S7 (chloroplast) [Brassica oleracea var. italica] gb|ASY94364.1| ribosomal protein S7 (chloroplast) [Raphanus raphanistrum subsp. landra] gb|ASY94379.1| ribosomal protein S7 (chloroplast) [Raphanus raphanistrum subsp. landra] gb|ASY94451.1| ribosomal protein S7 (chloroplast) [Raphanus sativus var. raphanistroides] gb|ASY94466.1| ribosomal protein S7 (chloroplast) [Raphanus sativus var. raphanistroides] gb|ASY94538.1| ribosomal protein S7 (chloroplast) [Raphanus sativus var. sativus] gb|ASY94553.1| ribosomal protein S7 (chloroplast) [Raphanus sativus var. sativus] gb|ASY94625.1| ribosomal protein S7 (chloroplast) [Raphanus sativus var. sativus] gb|ASY94640.1| ribosomal protein S7 (chloroplast) [Raphanus sativus var. sativus] gb|ASY94712.1| ribosomal protein S7 (chloroplast) [Brassica juncea subsp. integrifolia] gb|ASY94727.1| ribosomal protein S7 (chloroplast) [Brassica juncea subsp. integrifolia] gb|ASY94799.1| ribosomal protein S7 (chloroplast) [Brassica juncea subsp. integrifolia] gb|ASY94814.1| ribosomal protein S7 (chloroplast) [Brassica juncea subsp. integrifolia] gb|ASY94886.1| ribosomal protein S7 (chloroplast) [Brassica juncea] gb|ASY94901.1| ribosomal protein S7 (chloroplast) [Brassica juncea] gb|ASY94973.1| ribosomal protein S7 (chloroplast) [Brassica juncea subsp. integrifolia] gb|ASY94988.1| ribosomal protein S7 (chloroplast) [Brassica juncea subsp. integrifolia] gb|ASY95060.1| ribosomal protein S7 (chloroplast) [Brassica napus] gb|ASY95075.1| ribosomal protein S7 (chloroplast) [Brassica napus] gb|ASY95147.1| ribosomal protein S7 (chloroplast) [Brassica napus var. napus] gb|ASY95162.1| ribosomal protein S7 (chloroplast) [Brassica napus var. napus] gb|ASY95234.1| ribosomal protein S7 (chloroplast) [Brassica napus var. napus] gb|ASY95249.1| ribosomal protein S7 (chloroplast) [Brassica napus var. napus] gb|ASY95321.1| ribosomal protein S7 (chloroplast) [Brassica napus var. napus] gb|ASY95336.1| ribosomal protein S7 (chloroplast) [Brassica napus var. napus] gb|ASY95408.1| ribosomal protein S7 (chloroplast) [Brassica carinata] gb|ASY95423.1| ribosomal protein S7 (chloroplast) [Brassica carinata] gb|ASY95495.1| ribosomal protein S7 (chloroplast) [Brassica carinata] gb|ASY95510.1| ribosomal protein S7 (chloroplast) [Brassica carinata] gb|ASY95582.1| ribosomal protein S7 (chloroplast) [Brassica carinata] gb|ASY95597.1| ribosomal protein S7 (chloroplast) [Brassica carinata] gb|ASY95669.1| ribosomal protein S7 (chloroplast) [Brassica carinata] gb|ASY95684.1| ribosomal protein S7 (chloroplast) [Brassica carinata] emb|CUA64855.1| ribosomal protein S7 (chloroplast) [Bunias orientalis] emb|CUA64869.1| ribosomal protein S7 (chloroplast) [Bunias orientalis] emb|CUA64940.1| ribosomal protein S7 (chloroplast) [Bunias erucago] emb|CUA64954.1| ribosomal protein S7 (chloroplast) [Bunias erucago] emb|CUA65025.1| ribosomal protein S7 (chloroplast) [Bunias orientalis] emb|CUA65039.1| ribosomal protein S7 (chloroplast) [Bunias orientalis] emb|CUA65110.1| ribosomal protein S7 (chloroplast) [Bunias orientalis] emb|CUA65124.1| ribosomal protein S7 (chloroplast) [Bunias orientalis] emb|SOF61645.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOF61659.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99875.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99939.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99685.1| ribosomal protein S7 (plastid) [Arabidopsis arenosa subsp. borbasii] emb|SOG99858.1| ribosomal protein S7 (plastid) [Arabidopsis arenosa subsp. borbasii] emb|SOG99765.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99902.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99324.1| ribosomal protein S7 (plastid) [Arabidopsis arenosa subsp. borbasii] emb|SOG99589.1| ribosomal protein S7 (plastid) [Arabidopsis arenosa subsp. borbasii] emb|SOG99907.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99949.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99826.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99912.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99605.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99802.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99479.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99759.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99551.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99775.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99478.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99741.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99371.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99615.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99459.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99739.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99291.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99613.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOH00215.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOH00229.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOH00300.1| ribosomal protein S7 (plastid) [Arabidopsis arenosa subsp. borbasii] emb|SOH00314.1| ribosomal protein S7 (plastid) [Arabidopsis arenosa subsp. borbasii] emb|SOG99351.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99603.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99514.1| ribosomal protein S7 (plastid) [Arabidopsis arenosa subsp. borbasii] emb|SOG99803.1| ribosomal protein S7 (plastid) [Arabidopsis arenosa subsp. borbasii] emb|SOG99245.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99513.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99960.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99974.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99835.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99910.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99534.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99772.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99550.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99779.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99432.1| ribosomal protein S7 (plastid) [Arabidopsis arenosa subsp. borbasii] emb|SOG99745.1| ribosomal protein S7 (plastid) [Arabidopsis arenosa subsp. borbasii] emb|SOG99647.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOG99854.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOH00102.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOH00130.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOH00139.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOH00153.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOH00385.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] emb|SOH00399.1| ribosomal protein S7 (plastid) [Arabidopsis lyrata subsp. petraea] gb|ATJ03165.1| ribosomal protein S7 (chloroplast) [Cardamine macrophylla] gb|ATJ03166.1| ribosomal protein S7 (chloroplast) [Cardamine macrophylla] gb|ATU85621.1| ribosomal protein S7 (chloroplast) [Firmiana pulcherrima] gb|ATU85634.1| ribosomal protein S7 (chloroplast) [Firmiana pulcherrima] gb|PKU32146.1| ribosomal protein s7 [Limosa lapponica baueri] gb|AUT81268.1| ribosomal protein S7 (chloroplast) [Tapiscia sinensis] gb|AUT81281.1| ribosomal protein S7 (chloroplast) [Tapiscia sinensis] gb|AUT81568.1| ribosomal protein S7 (plastid) [Cardamine amara] gb|AUT81569.1| ribosomal protein S7 (plastid) [Cardamine amara] gb|AUT81654.1| ribosomal protein S7 (plastid) [Cardamine oligosperma] gb|AUT81655.1| ribosomal protein S7 (plastid) [Cardamine oligosperma] gb|AUT81740.1| ribosomal protein S7 (plastid) [Cardamine parviflora] gb|AUT81741.1| ribosomal protein S7 (plastid) [Cardamine parviflora] gb|AVH80371.1| ribosomal protein S7 (chloroplast) [Firmiana major] gb|AVH80372.1| ribosomal protein S7 (chloroplast) [Firmiana major] dbj|BBC42885.1| 30S ribosomal protein S7 (chloroplast) [Arabis hirsuta var. nipponica] dbj|BBC42899.1| 30S ribosomal protein S7 (chloroplast) [Arabis hirsuta var. nipponica] dbj|BBC42971.1| 30S ribosomal protein S7 (chloroplast) [Arabis hirsuta] dbj|BBC42985.1| 30S ribosomal protein S7 (chloroplast) [Arabis hirsuta] dbj|BBC43057.1| 30S ribosomal protein S7 (chloroplast) [Arabis flagellosa] dbj|BBC43071.1| 30S ribosomal protein S7 (chloroplast) [Arabis flagellosa] Length = 155 Score = 301 bits (771), Expect = 2e-99 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRA+KKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRALKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_567124.1| ribosomal protein S7 (chloroplast) [Vitis vinifera] ref|YP_567137.1| ribosomal protein S7 (chloroplast) [Vitis vinifera] ref|YP_009019837.1| ribosomal protein S7 (chloroplast) [Vitis rotundifolia] ref|YP_009019850.1| ribosomal protein S7 (chloroplast) [Vitis rotundifolia] ref|YP_009235390.1| ribosomal protein S7 (chloroplast) [Vitis aestivalis] ref|YP_009235403.1| ribosomal protein S7 (chloroplast) [Vitis aestivalis] ref|YP_009306985.1| ribosomal protein S7 (chloroplast) [Vitis amurensis] ref|YP_009306998.1| ribosomal protein S7 (chloroplast) [Vitis amurensis] ref|YP_009433151.1| ribosomal protein S7 (chloroplast) [Vitis mustangensis] ref|YP_009433164.1| ribosomal protein S7 (chloroplast) [Vitis mustangensis] ref|YP_009428222.1| ribosomal protein S7 (chloroplast) [Vitis acerifolia] ref|YP_009428235.1| ribosomal protein S7 (chloroplast) [Vitis acerifolia] ref|YP_009437809.1| ribosomal protein S7 (chloroplast) [Vitis x champinii] ref|YP_009437822.1| ribosomal protein S7 (chloroplast) [Vitis x champinii] ref|YP_009442952.1| ribosomal protein S7 (chloroplast) [Vitis cinerea] ref|YP_009442965.1| ribosomal protein S7 (chloroplast) [Vitis cinerea] ref|YP_009444262.1| ribosomal protein S7 (chloroplast) [Vitis coignetiae] ref|YP_009444275.1| ribosomal protein S7 (chloroplast) [Vitis coignetiae] ref|YP_009447693.1| ribosomal protein S7 (chloroplast) [Vitis cordifolia] ref|YP_009447706.1| ribosomal protein S7 (chloroplast) [Vitis cordifolia] ref|YP_009447779.1| ribosomal protein S7 (chloroplast) [Vitis ficifolia] ref|YP_009447792.1| ribosomal protein S7 (chloroplast) [Vitis ficifolia] ref|YP_009455636.1| ribosomal protein S7 (chloroplast) [Vitis rupestris] ref|YP_009455649.1| ribosomal protein S7 (chloroplast) [Vitis rupestris] sp|Q0ZIV9.1|RR7_VITVI RecName: Full=30S ribosomal protein S7, chloroplastic gb|ABE47580.1| ribosomal protein S7 (chloroplast) [Vitis vinifera] gb|ABE47595.1| ribosomal protein S7 (chloroplast) [Vitis vinifera] emb|CAN66876.1| hypothetical protein VITISV_009277 [Vitis vinifera] emb|CAN75505.1| hypothetical protein VITISV_032153 [Vitis vinifera] dbj|BAO01539.1| ribosomal protein S7 (chloroplast) [Vitis vinifera subsp. caucasica] dbj|BAO01552.1| ribosomal protein S7 (chloroplast) [Vitis vinifera subsp. caucasica] dbj|BAO01623.1| ribosomal protein S7 (chloroplast) [Vitis vinifera subsp. caucasica] dbj|BAO01636.1| ribosomal protein S7 (chloroplast) [Vitis vinifera subsp. caucasica] dbj|BAO01707.1| ribosomal protein S7 (chloroplast) [Vitis vinifera subsp. caucasica] dbj|BAO01720.1| ribosomal protein S7 (chloroplast) [Vitis vinifera subsp. caucasica] gb|AHJ91256.1| ribosomal protein S7 (chloroplast) [Vitis rotundifolia] gb|AHJ91269.1| ribosomal protein S7 (chloroplast) [Vitis rotundifolia] gb|AMD12065.1| ribosomal protein S7 (chloroplast) [Vitis aestivalis] gb|AMD12078.1| ribosomal protein S7 (chloroplast) [Vitis aestivalis] gb|AOR52728.1| ribosomal protein S7 (chloroplast) [Vitis amurensis] gb|AOR52729.1| ribosomal protein S7 (chloroplast) [Vitis amurensis] dbj|BBA26395.1| ribosomal protein S7 (chloroplast) [Vitis acerifolia] dbj|BBA26408.1| ribosomal protein S7 (chloroplast) [Vitis acerifolia] dbj|BBA27202.1| ribosomal protein S7 (chloroplast) [Vitis aestivalis] dbj|BBA27215.1| ribosomal protein S7 (chloroplast) [Vitis aestivalis] dbj|BBA31584.1| ribosomal protein S7 (chloroplast) [Vitis amurensis] dbj|BBA31597.1| ribosomal protein S7 (chloroplast) [Vitis amurensis] dbj|BBA46243.1| ribosomal protein S7 (chloroplast) [Vitis cinerea var. helleri] dbj|BBA46256.1| ribosomal protein S7 (chloroplast) [Vitis cinerea var. helleri] dbj|BBA53967.1| ribosomal protein S7 (chloroplast) [Vitis mustangensis] dbj|BBA53980.1| ribosomal protein S7 (chloroplast) [Vitis mustangensis] dbj|BBA54836.1| ribosomal protein S7 (chloroplast) [Vitis x champinii] dbj|BBA54849.1| ribosomal protein S7 (chloroplast) [Vitis x champinii] dbj|BBB03606.1| ribosomal protein S7 (chloroplast) [Vitis cinerea] dbj|BBB03619.1| ribosomal protein S7 (chloroplast) [Vitis cinerea] dbj|BBB04625.1| ribosomal protein S7 (chloroplast) [Vitis coignetiae] dbj|BBB04638.1| ribosomal protein S7 (chloroplast) [Vitis coignetiae] dbj|BBB36023.1| ribosomal protein S7 (chloroplast) [Vitis cordifolia] dbj|BBB36036.1| ribosomal protein S7 (chloroplast) [Vitis cordifolia] dbj|BBB38453.1| ribosomal protein S7 (chloroplast) [Vitis ficifolia] dbj|BBB38466.1| ribosomal protein S7 (chloroplast) [Vitis ficifolia] dbj|BBB56009.1| ribosomal protein S7 (chloroplast) [Vitis flexuosa] dbj|BBB56022.1| ribosomal protein S7 (chloroplast) [Vitis flexuosa] dbj|BBB94413.1| ribosomal protein S7 (chloroplast) [Vitis monticola] dbj|BBB94426.1| ribosomal protein S7 (chloroplast) [Vitis monticola] dbj|BBC15002.1| ribosomal protein S7 (chloroplast) [Vitis rupestris] dbj|BBC15015.1| ribosomal protein S7 (chloroplast) [Vitis rupestris] Length = 155 Score = 301 bits (771), Expect = 2e-99 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR+VKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRSVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009261910.1| ribosomal protein S7 (chloroplast) [Parastemon urophyllus] ref|YP_009261923.1| ribosomal protein S7 (chloroplast) [Parastemon urophyllus] gb|ANJ20346.1| ribosomal protein S7 (chloroplast) [Parastemon urophyllus] gb|ANJ20347.1| ribosomal protein S7 (chloroplast) [Parastemon urophyllus] Length = 155 Score = 301 bits (770), Expect = 3e-99 Identities = 154/155 (99%), Positives = 154/155 (99%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVK RRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKVRRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >gb|ABQ14920.1| ribosomal protein S7 (chloroplast) [Rhodoleia championii] gb|ADD29891.1| ribosomal protein S7 (chloroplast) [Dillenia indica] gb|AEK71672.1| ribosomal protein S7 (plastid) [Dillenia indica] gb|AEK71855.1| ribosomal protein S7 (plastid) [Cissus rotundifolia] Length = 155 Score = 301 bits (770), Expect = 3e-99 Identities = 154/155 (99%), Positives = 154/155 (99%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGT EEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTTEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_009109042.1| ribosomal protein S7 (plastid) [Corallorhiza macrantha] ref|YP_009109048.1| ribosomal protein S7 (plastid) [Corallorhiza macrantha] ref|YP_009109103.1| ribosomal protein S7 (plastid) [Corallorhiza mertensiana] ref|YP_009109108.1| ribosomal protein S7 (plastid) [Corallorhiza mertensiana] ref|YP_009129404.1| ribosomal protein S7 (chloroplast) [Cypripedium formosanum] ref|YP_009129390.1| ribosomal protein S7 (chloroplast) [Cypripedium formosanum] ref|YP_009129906.1| ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] ref|YP_009129897.1| ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] ref|YP_009144820.1| ribosomal protein S7 (chloroplast) [Elleanthus sodiroi] ref|YP_009144833.1| ribosomal protein S7 (chloroplast) [Elleanthus sodiroi] ref|YP_009143935.1| ribosomal protein S7 (plastid) [Cypripedium japonicum] ref|YP_009143948.1| ribosomal protein S7 (plastid) [Cypripedium japonicum] ref|YP_009176554.1| ribosomal protein S7 (chloroplast) [Sobralia aff. bouchei HTK-2015] ref|YP_009176567.1| ribosomal protein S7 (chloroplast) [Sobralia aff. bouchei HTK-2015] ref|YP_009175159.1| ribosomal protein S7 (chloroplast) [Sobralia callosa] ref|YP_009175172.1| ribosomal protein S7 (chloroplast) [Sobralia callosa] ref|YP_009179996.1| 30S ribosomal protein S7 (chloroplast) [Bletilla striata] ref|YP_009180005.1| 30S ribosomal protein S7 (chloroplast) [Bletilla striata] ref|YP_009236246.1| 30S ribosomal protein S7 (chloroplast) [Bletilla ochracea] ref|YP_009236255.1| 30S ribosomal protein S7 (chloroplast) [Bletilla ochracea] ref|YP_009269607.1| ribosomal protein S7 (chloroplast) [Cephalanthera longifolia] ref|YP_009269620.1| ribosomal protein S7 (chloroplast) [Cephalanthera longifolia] ref|YP_009270091.1| ribosomal protein S7 (chloroplast) [Listera fugongensis] ref|YP_009270104.1| ribosomal protein S7 (chloroplast) [Listera fugongensis] ref|YP_009269694.1| ribosomal protein S7 (chloroplast) [Epipactis mairei] ref|YP_009269705.1| ribosomal protein S7 (chloroplast) [Epipactis mairei] ref|YP_009269772.1| ribosomal protein S7 (plastid) [Cephalanthera humilis] ref|YP_009269780.1| ribosomal protein S7 (plastid) [Cephalanthera humilis] ref|YP_009269890.1| ribosomal protein S7 (chloroplast) [Epipactis veratrifolia] ref|YP_009269903.1| ribosomal protein S7 (chloroplast) [Epipactis veratrifolia] ref|YP_009270005.1| ribosomal protein S7 (chloroplast) [Neottia pinetorum] ref|YP_009270018.1| ribosomal protein S7 (chloroplast) [Neottia pinetorum] ref|YP_009270178.1| ribosomal protein S7 (chloroplast) [Neottia ovata] ref|YP_009270191.1| ribosomal protein S7 (chloroplast) [Neottia ovata] ref|YP_009270222.1| ribosomal protein S7 (plastid) [Neottia listeroides] ref|YP_009270226.1| ribosomal protein S7 (plastid) [Neottia listeroides] ref|YP_009270602.1| ribosomal protein S7 (chloroplast) [Apostasia odorata] ref|YP_009270589.1| ribosomal protein S7 (chloroplast) [Apostasia odorata] ref|YP_009424978.1| ribosomal protein S7 (chloroplast) [Habenaria radiata] ref|YP_009424991.1| ribosomal protein S7 (chloroplast) [Habenaria radiata] ref|YP_009443192.1| 30S ribosomal protein S7 (chloroplast) [Pleione bulbocodioides] ref|YP_009443206.1| 30S ribosomal protein S7 (chloroplast) [Pleione bulbocodioides] ref|YP_009460035.1| ribosomal protein S7 (chloroplast) [Paphiopedilum dianthum] ref|YP_009460044.1| ribosomal protein S7 (chloroplast) [Paphiopedilum dianthum] sp|Q67IG9.1|RR7_COECR RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAN32034.1| ribosomal protein S7 (chloroplast) [Coelogyne cristata] gb|AAN32043.1| ribosomal protein S7 (chloroplast) [Cypripedium passerinum] gb|AAN32057.1| ribosomal protein S7 (chloroplast) [Galearis rotundifolia] gb|AFG25679.1| ribosomal protein S7, partial (plastid) [Apostasia wallichii] gb|AHZ43012.1| ribosomal protein S7 (chloroplast) [Cypripedium formosanum] gb|AHZ43013.1| ribosomal protein S7 (chloroplast) [Cypripedium formosanum] gb|AIC37322.1| ribosomal protein S7 (plastid) [Cypripedium japonicum] gb|AIC37334.1| ribosomal protein S7 (plastid) [Cypripedium japonicum] gb|AID52286.1| ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] gb|AID52287.1| ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] gb|AIS67418.1| ribosomal protein S7 (chloroplast) [Sobralia callosa] gb|AIS67431.1| ribosomal protein S7 (chloroplast) [Sobralia callosa] gb|AIW51306.1| ribosomal protein S7 (plastid) [Corallorhiza maculata var. maculata] gb|AIW51313.1| ribosomal protein S7 (plastid) [Corallorhiza maculata var. maculata] gb|AIW51438.1| ribosomal protein S7 (plastid) [Corallorhiza maculata var. occidentalis] gb|AIW51446.1| ribosomal protein S7 (plastid) [Corallorhiza maculata var. occidentalis] gb|AIW51510.1| ribosomal protein S7 (plastid) [Corallorhiza macrantha] gb|AIW51518.1| ribosomal protein S7 (plastid) [Corallorhiza macrantha] gb|AIW51571.1| ribosomal protein S7 (plastid) [Corallorhiza mertensiana] gb|AIW51578.1| ribosomal protein S7 (plastid) [Corallorhiza mertensiana] gb|AIY56228.1| ribosomal protein S7 (chloroplast) [Neuwiedia zollingeri var. singapureana] gb|AIY56229.1| ribosomal protein S7 (chloroplast) [Neuwiedia zollingeri var. singapureana] gb|AIY61332.1| ribosomal protein S7 (chloroplast) [Apostasia odorata] gb|AIY61333.1| ribosomal protein S7 (chloroplast) [Apostasia odorata] gb|AKJ77427.1| ribosomal protein S7 (chloroplast) [Elleanthus sodiroi] gb|AKJ77439.1| ribosomal protein S7 (chloroplast) [Elleanthus sodiroi] gb|ALJ02026.1| ribosomal protein S7 (chloroplast) [Sobralia aff. bouchei HTK-2015] gb|ALJ02038.1| ribosomal protein S7 (chloroplast) [Sobralia aff. bouchei HTK-2015] gb|ALJ02113.1| ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] gb|ALJ02122.1| ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] gb|ALL53030.1| 30S ribosomal protein S7 (chloroplast) [Bletilla striata] gb|ALL53031.1| 30S ribosomal protein S7 (chloroplast) [Bletilla striata] gb|AMF83941.1| 30S ribosomal protein S7 (chloroplast) [Bletilla ochracea] gb|AMF83942.1| 30S ribosomal protein S7 (chloroplast) [Bletilla ochracea] gb|ANT72515.1| ribosomal protein S7 (chloroplast) [Cephalanthera longifolia] gb|ANT72529.1| ribosomal protein S7 (chloroplast) [Cephalanthera longifolia] gb|ANT72604.1| ribosomal protein S7 (chloroplast) [Epipactis mairei] gb|ANT72615.1| ribosomal protein S7 (chloroplast) [Epipactis mairei] gb|ANT72680.1| ribosomal protein S7 (plastid) [Cephalanthera humilis] gb|ANT72689.1| ribosomal protein S7 (plastid) [Cephalanthera humilis] gb|ANT72798.1| ribosomal protein S7 (chloroplast) [Epipactis veratrifolia] gb|ANT72812.1| ribosomal protein S7 (chloroplast) [Epipactis veratrifolia] gb|ANT72912.1| ribosomal protein S7 (chloroplast) [Neottia pinetorum] gb|ANT72926.1| ribosomal protein S7 (chloroplast) [Neottia pinetorum] gb|ANT72998.1| ribosomal protein S7 (chloroplast) [Listera fugongensis] gb|ANT73011.1| ribosomal protein S7 (chloroplast) [Listera fugongensis] gb|ANT73084.1| ribosomal protein S7 (chloroplast) [Neottia ovata] gb|ANT73099.1| ribosomal protein S7 (chloroplast) [Neottia ovata] gb|ANT73129.1| ribosomal protein S7 (plastid) [Neottia listeroides] gb|ANT73134.1| ribosomal protein S7 (plastid) [Neottia listeroides] dbj|BAX88122.1| 30S ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] dbj|BAX88127.1| 30S ribosomal protein S7 (chloroplast) [Paphiopedilum armeniacum] gb|ASU93507.1| ribosomal protein S7 (chloroplast) [Habenaria radiata] gb|ASU93520.1| ribosomal protein S7 (chloroplast) [Habenaria radiata] gb|ATP74799.1| 30S ribosomal protein S7 (chloroplast) [Pleione bulbocodioides] gb|ATP74857.1| 30S ribosomal protein S7 (chloroplast) [Pleione bulbocodioides] dbj|BBB03227.1| 30S ribosomal protein S7 (chloroplast) [Neuwiedia zollingeri var. singapureana] dbj|BBB03233.1| 30S ribosomal protein S7 (chloroplast) [Neuwiedia zollingeri var. singapureana] gb|AUT77262.1| ribosomal protein S7 (chloroplast) [Paphiopedilum dianthum] gb|AUT77263.1| ribosomal protein S7 (chloroplast) [Paphiopedilum dianthum] dbj|BBD13736.1| 30S ribosomal protein S7, partial (chloroplast) [Neuwiedia zollingeri var. singapureana] dbj|BBD13792.1| 30S ribosomal protein S7, partial (chloroplast) [Cypripedium japonicum] gb|AVM10602.1| ribosomal protein S7 (chloroplast) [Epipactis mairei] gb|AVM10603.1| ribosomal protein S7 (chloroplast) [Epipactis mairei] gb|AVM10689.1| ribosomal protein S7 (chloroplast) [Platanthera japonica] gb|AVM10690.1| ribosomal protein S7 (chloroplast) [Platanthera japonica] Length = 155 Score = 301 bits (770), Expect = 3e-99 Identities = 154/155 (99%), Positives = 155/155 (100%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAF+L Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFQL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155 >ref|YP_001294399.1| ribosomal protein S7 [Dioscorea elephantipes] ref|YP_001294412.1| ribosomal protein S7 [Dioscorea elephantipes] ref|YP_009033931.1| ribosomal protein S7 (plastid) [Dioscorea rotundata] ref|YP_009033944.1| ribosomal protein S7 (plastid) [Dioscorea rotundata] ref|YP_009139148.1| ribosomal protein S7 (chloroplast) [Dioscorea zingiberensis] ref|YP_009139161.1| ribosomal protein S7 (chloroplast) [Dioscorea zingiberensis] ref|YP_009365537.1| ribosomal protein S7 (plastid) [Dioscorea villosa] ref|YP_009365550.1| ribosomal protein S7 (plastid) [Dioscorea villosa] ref|YP_009449836.1| ribosomal protein S7 (chloroplast) [Tacca leontopetaloides] ref|YP_009449852.1| ribosomal protein S7 (chloroplast) [Tacca leontopetaloides] sp|Q9GFL8.1|RR7_DIOBU RecName: Full=30S ribosomal protein S7, chloroplastic sp|A6MMQ4.1|RR7_DIOEL RecName: Full=30S ribosomal protein S7, chloroplastic gb|AAG26110.1| ribosomal protein S7 (chloroplast) [Dioscorea bulbifera] gb|ABR01476.1| ribosomal protein S7 (chloroplast) [Dioscorea elephantipes] gb|ABR01489.1| ribosomal protein S7 (chloroplast) [Dioscorea elephantipes] gb|AHZ18176.1| ribosomal protein S7 (plastid) [Dioscorea rotundata] gb|AHZ18189.1| ribosomal protein S7 (plastid) [Dioscorea rotundata] gb|AKF33649.1| ribosomal protein S7 (chloroplast) [Dioscorea zingiberensis] gb|AKF33650.1| ribosomal protein S7 (chloroplast) [Dioscorea zingiberensis] gb|AKJ77599.1| ribosomal protein S7 (chloroplast) [Dioscorea nipponica] gb|AKJ77608.1| ribosomal protein S7 (chloroplast) [Dioscorea nipponica] gb|ANA91364.1| ribosomal protein S7 (chloroplast) [Tacca leontopetaloides] gb|ANA91380.1| ribosomal protein S7 (chloroplast) [Tacca leontopetaloides] gb|ANP26151.1| ribosomal protein S7 (plastid) [Tacca chantrieri] gb|ANP26168.1| ribosomal protein S7 (plastid) [Tacca chantrieri] gb|ARJ61036.1| ribosomal protein S7 (plastid) [Dioscorea villosa] gb|ARJ61037.1| ribosomal protein S7 (plastid) [Dioscorea villosa] Length = 155 Score = 301 bits (770), Expect = 3e-99 Identities = 154/155 (99%), Positives = 154/155 (99%) Frame = -2 Query: 588 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLS 409 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR VKKIQQKTETNPLS Sbjct: 1 MSRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRTVKKIQQKTETNPLS 60 Query: 408 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 229 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL Sbjct: 61 VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKL 120 Query: 228 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 124 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR Sbjct: 121 SSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR 155