BLASTX nr result
ID: Ophiopogon27_contig00026218
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00026218 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259379.1| uncharacterized protein LOC109835773 [Aspara... 63 1e-09 ref|XP_010273216.1| PREDICTED: WPP domain-interacting tail-ancho... 56 4e-06 ref|XP_010273214.1| PREDICTED: WPP domain-interacting tail-ancho... 56 4e-06 >ref|XP_020259379.1| uncharacterized protein LOC109835773 [Asparagus officinalis] gb|ONK76765.1| uncharacterized protein A4U43_C03F31900 [Asparagus officinalis] Length = 132 Score = 62.8 bits (151), Expect = 1e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -2 Query: 424 KMETVRTIEPTQLNFKYLFLAVLVLLASIFAVYMFQLE 311 ++E VRTIE TQLNFKYLF+A+L+LL SIFA+Y+FQLE Sbjct: 95 QLEPVRTIEATQLNFKYLFMAILILLVSIFAIYLFQLE 132 >ref|XP_010273216.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like isoform X2 [Nelumbo nucifera] Length = 731 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = -2 Query: 427 SKMETVRTIEPTQLNFKYLFLAVLVLLASIFAVYMFQLEN 308 SK++TVRTIE QLNFKY+F+AV +LL S+ AVY+FQ ++ Sbjct: 683 SKVDTVRTIEAGQLNFKYVFMAVFILLISVLAVYLFQQDS 722 >ref|XP_010273214.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like isoform X1 [Nelumbo nucifera] Length = 736 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = -2 Query: 427 SKMETVRTIEPTQLNFKYLFLAVLVLLASIFAVYMFQLEN 308 SK++TVRTIE QLNFKY+F+AV +LL S+ AVY+FQ ++ Sbjct: 688 SKVDTVRTIEAGQLNFKYVFMAVFILLISVLAVYLFQQDS 727