BLASTX nr result
ID: Ophiopogon27_contig00026141
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00026141 (532 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK74709.1| uncharacterized protein A4U43_C03F9330 [Asparagus... 64 6e-09 ref|XP_020256489.1| glycerol-3-phosphate acyltransferase 3-like ... 64 1e-08 ref|XP_020256490.1| glycerol-3-phosphate acyltransferase 3-like ... 64 1e-08 gb|PKA60207.1| Lysophospholipid acyltransferase LPEAT1 [Apostasi... 55 9e-06 >gb|ONK74709.1| uncharacterized protein A4U43_C03F9330 [Asparagus officinalis] Length = 256 Score = 63.9 bits (154), Expect = 6e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 414 LMYGCRVFILAAGWILFI*AFFPVHFILAGHNKCMRKIE 530 +++ RVFILAAGWILF AFFPVHF+LAGHNK RKIE Sbjct: 93 ILFPTRVFILAAGWILFFSAFFPVHFLLAGHNKWRRKIE 131 >ref|XP_020256489.1| glycerol-3-phosphate acyltransferase 3-like isoform X1 [Asparagus officinalis] Length = 374 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 414 LMYGCRVFILAAGWILFI*AFFPVHFILAGHNKCMRKIE 530 +++ RVFILAAGWILF AFFPVHF+LAGHNK RKIE Sbjct: 93 ILFPTRVFILAAGWILFFSAFFPVHFLLAGHNKWRRKIE 131 >ref|XP_020256490.1| glycerol-3-phosphate acyltransferase 3-like isoform X2 [Asparagus officinalis] Length = 377 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 414 LMYGCRVFILAAGWILFI*AFFPVHFILAGHNKCMRKIE 530 +++ RVFILAAGWILF AFFPVHF+LAGHNK RKIE Sbjct: 93 ILFPTRVFILAAGWILFFSAFFPVHFLLAGHNKWRRKIE 131 >gb|PKA60207.1| Lysophospholipid acyltransferase LPEAT1 [Apostasia shenzhenica] Length = 412 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 414 LMYGCRVFILAAGWILFI*AFFPVHFILAGHNKCMRKIE 530 +++ RV ILA GWI+F AF PVHF+LAGHNK RK+E Sbjct: 132 ILFPLRVVILALGWIVFFAAFLPVHFLLAGHNKWKRKVE 170