BLASTX nr result
ID: Ophiopogon27_contig00026132
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00026132 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAY70623.1| hypothetical protein ACMD2_27059, partial [Ananas... 43 4e-07 >gb|OAY70623.1| hypothetical protein ACMD2_27059, partial [Ananas comosus] Length = 363 Score = 43.1 bits (100), Expect(2) = 4e-07 Identities = 17/50 (34%), Positives = 33/50 (66%) Frame = +1 Query: 25 VIFVSSVYDAPYLNIREDFWNEFKNLRQLANYRWVIDGDFNVTHFFTEKR 174 + ++++VY P + +EDF +E + L+ + +WVI GDFN T + +E++ Sbjct: 24 IFYLTNVYGPPTWDGKEDFCSELRALKGICTGKWVICGDFNFTRYQSERK 73 Score = 38.5 bits (88), Expect(2) = 4e-07 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +3 Query: 204 SMTFTWTK-HMSLSRARLNRFIISKSWILSHPLTFAKCLPSDVFDHVP 344 + +FTW+ S + A+L+RF++S W LS P K LP DH P Sbjct: 101 NQSFTWSNMQQSPTLAKLDRFLVSTEWDLSFPHRRVKALPRLTSDHTP 148