BLASTX nr result
ID: Ophiopogon27_contig00025560
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00025560 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274166.1| L-type lectin-domain containing receptor kin... 69 2e-11 ref|XP_020265326.1| L-type lectin-domain containing receptor kin... 58 3e-07 >ref|XP_020274166.1| L-type lectin-domain containing receptor kinase VIII.1-like [Asparagus officinalis] ref|XP_020274167.1| L-type lectin-domain containing receptor kinase VIII.1-like [Asparagus officinalis] gb|ONK62129.1| uncharacterized protein A4U43_C07F650 [Asparagus officinalis] Length = 319 Score = 69.3 bits (168), Expect = 2e-11 Identities = 36/60 (60%), Positives = 43/60 (71%) Frame = -3 Query: 182 GYISFSLLCFCALNADSLVKRPPFSFSFEKFRNDRSFGSQIRLYGDAEVSDSAWVRFFGK 3 GY F LLCF AL+ S+ ++ PFS SFEKF ND+ FGS+I LYGDAEV +S V FGK Sbjct: 8 GYAIFLLLCFSALSMGSVDEKLPFSLSFEKFENDQRFGSEIALYGDAEVRNST-VLMFGK 66 >ref|XP_020265326.1| L-type lectin-domain containing receptor kinase IV.3 isoform X1 [Asparagus officinalis] Length = 334 Score = 57.8 bits (138), Expect = 3e-07 Identities = 30/59 (50%), Positives = 40/59 (67%) Frame = -3 Query: 179 YISFSLLCFCALNADSLVKRPPFSFSFEKFRNDRSFGSQIRLYGDAEVSDSAWVRFFGK 3 + + SLLC A+ ++S+ + PFSFSF KF D F S++ LYGDAEVS+S V FGK Sbjct: 9 FTALSLLCLLAMRSESVGESSPFSFSFGKFEKDGRFVSRVALYGDAEVSNSG-VLAFGK 66