BLASTX nr result
ID: Ophiopogon27_contig00025376
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00025376 (841 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257934.1| probable xyloglucan endotransglucosylase/hyd... 73 4e-11 ref|XP_020104828.1| probable xyloglucan endotransglucosylase/hyd... 60 7e-07 >ref|XP_020257934.1| probable xyloglucan endotransglucosylase/hydrolase protein 10 [Asparagus officinalis] gb|ONK76155.1| uncharacterized protein A4U43_C03F24520 [Asparagus officinalis] Length = 294 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -1 Query: 607 MAMKSIRSVLIGLWFASIVRIVFGSVVSIGNFNQDFLITWSPNHVYTSP 461 M S+ SVLI +FA+++R+V GSVVS GNFN+DF +TWSPNHVYTSP Sbjct: 1 MGTMSVSSVLIVFFFANLLRLVLGSVVSTGNFNKDFFVTWSPNHVYTSP 49 >ref|XP_020104828.1| probable xyloglucan endotransglucosylase/hydrolase protein 10 [Ananas comosus] Length = 303 Score = 60.5 bits (145), Expect = 7e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -1 Query: 586 SVLIGLWFASIVRIVFGSVVSIGNFNQDFLITWSPNHVYTSP 461 ++LI L FA ++RI F S+VS GNFN+DF I WSP+H+ TSP Sbjct: 17 TILIWLLFADLIRIAFASIVSTGNFNEDFYIAWSPSHINTSP 58