BLASTX nr result
ID: Ophiopogon27_contig00025372
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00025372 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006851502.1| probable uridine nucleosidase 1 [Amborella t... 57 2e-06 ref|XP_020247744.1| probable uridine nucleosidase 1 [Asparagus o... 57 2e-06 ref|XP_010943708.1| PREDICTED: probable uridine nucleosidase 1 [... 57 2e-06 gb|KMZ68689.1| Uridine nucleosidase 1 [Zostera marina] 56 3e-06 ref|XP_008801224.1| PREDICTED: probable uridine nucleosidase 1 i... 56 4e-06 ref|XP_017700261.1| PREDICTED: probable uridine nucleosidase 1 i... 56 4e-06 ref|XP_009393378.1| PREDICTED: probable uridine nucleosidase 1 [... 56 4e-06 ref|XP_008801222.1| PREDICTED: probable uridine nucleosidase 1 i... 56 4e-06 ref|XP_013602804.1| PREDICTED: probable uridine nucleosidase 2 [... 54 4e-06 gb|ABK24733.1| unknown [Picea sitchensis] 56 4e-06 ref|XP_008808554.1| PREDICTED: uridine nucleosidase 1-like isofo... 55 5e-06 ref|XP_008808553.1| PREDICTED: probable uridine nucleosidase 1 i... 55 5e-06 ref|XP_020703372.1| uridine nucleosidase 1 isoform X1 [Dendrobiu... 55 7e-06 gb|PKU87309.1| Uridine nucleosidase 1 [Dendrobium catenatum] 55 7e-06 >ref|XP_006851502.1| probable uridine nucleosidase 1 [Amborella trichopoda] gb|ERN13083.1| hypothetical protein AMTR_s00040p00153690 [Amborella trichopoda] Length = 329 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQVAL 474 IYGDPE ADIVFTCGA+IV VGINITTQV L Sbjct: 181 IYGDPEAADIVFTCGADIVIVGINITTQVIL 211 >ref|XP_020247744.1| probable uridine nucleosidase 1 [Asparagus officinalis] Length = 325 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQVAL 474 IYGDPE ADIVFTCGAEIV VGINITTQ L Sbjct: 177 IYGDPEAADIVFTCGAEIVVVGINITTQAIL 207 >ref|XP_010943708.1| PREDICTED: probable uridine nucleosidase 1 [Elaeis guineensis] Length = 337 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQV 468 IYGDPE ADIVFTCGA+IV VGINITTQV Sbjct: 189 IYGDPEAADIVFTCGADIVGVGINITTQV 217 >gb|KMZ68689.1| Uridine nucleosidase 1 [Zostera marina] Length = 342 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQVAL 474 +YGDPE ADIVFTCGA+I+ VGINITTQV L Sbjct: 194 VYGDPEAADIVFTCGADIIVVGINITTQVQL 224 >ref|XP_008801224.1| PREDICTED: probable uridine nucleosidase 1 isoform X3 [Phoenix dactylifera] ref|XP_008801225.1| PREDICTED: probable uridine nucleosidase 1 isoform X3 [Phoenix dactylifera] Length = 301 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQV 468 IYGDPE ADIVFTCGA+IV VGINITTQV Sbjct: 153 IYGDPEAADIVFTCGADIVVVGINITTQV 181 >ref|XP_017700261.1| PREDICTED: probable uridine nucleosidase 1 isoform X2 [Phoenix dactylifera] Length = 303 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQV 468 IYGDPE ADIVFTCGA+IV VGINITTQV Sbjct: 155 IYGDPEAADIVFTCGADIVVVGINITTQV 183 >ref|XP_009393378.1| PREDICTED: probable uridine nucleosidase 1 [Musa acuminata subsp. malaccensis] Length = 337 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQVAL 474 IYGDPE AD+VFTCGA++V VGIN+TTQV L Sbjct: 189 IYGDPEAADVVFTCGADVVVVGINVTTQVKL 219 >ref|XP_008801222.1| PREDICTED: probable uridine nucleosidase 1 isoform X1 [Phoenix dactylifera] Length = 338 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQV 468 IYGDPE ADIVFTCGA+IV VGINITTQV Sbjct: 190 IYGDPEAADIVFTCGADIVVVGINITTQV 218 >ref|XP_013602804.1| PREDICTED: probable uridine nucleosidase 2 [Brassica oleracea var. oleracea] Length = 163 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/37 (59%), Positives = 32/37 (86%) Frame = +1 Query: 364 YICAMQIYGDPEVADIVFTCGAEIVDVGINITTQVAL 474 ++ +++I+GDPE ADIVFTCGA+I+ VGIN+T QV + Sbjct: 9 HLTSVKIFGDPEAADIVFTCGADIIAVGINVTHQVVM 45 >gb|ABK24733.1| unknown [Picea sitchensis] Length = 339 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQVAL 474 +YGDPE ADIVFTCGAEIV VG+N+TTQV + Sbjct: 191 VYGDPEAADIVFTCGAEIVIVGLNVTTQVLM 221 >ref|XP_008808554.1| PREDICTED: uridine nucleosidase 1-like isoform X2 [Phoenix dactylifera] Length = 302 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQV 468 IYGDPE AD+VFTCGA+IV VGINITTQV Sbjct: 154 IYGDPEAADVVFTCGADIVVVGINITTQV 182 >ref|XP_008808553.1| PREDICTED: probable uridine nucleosidase 1 isoform X1 [Phoenix dactylifera] Length = 337 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQV 468 IYGDPE AD+VFTCGA+IV VGINITTQV Sbjct: 189 IYGDPEAADVVFTCGADIVVVGINITTQV 217 >ref|XP_020703372.1| uridine nucleosidase 1 isoform X1 [Dendrobium catenatum] Length = 301 Score = 55.1 bits (131), Expect = 7e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQVAL 474 IYGDPE ADI+FTCGA+++ VGINITTQ+ L Sbjct: 153 IYGDPEAADILFTCGADVIVVGINITTQITL 183 >gb|PKU87309.1| Uridine nucleosidase 1 [Dendrobium catenatum] Length = 320 Score = 55.1 bits (131), Expect = 7e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 382 IYGDPEVADIVFTCGAEIVDVGINITTQVAL 474 IYGDPE ADI+FTCGA+++ VGINITTQ+ L Sbjct: 172 IYGDPEAADILFTCGADVIVVGINITTQITL 202