BLASTX nr result
ID: Ophiopogon27_contig00025370
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00025370 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244111.1| pentatricopeptide repeat-containing protein ... 84 2e-16 >ref|XP_020244111.1| pentatricopeptide repeat-containing protein At3g22690 [Asparagus officinalis] ref|XP_020244112.1| pentatricopeptide repeat-containing protein At3g22690 [Asparagus officinalis] ref|XP_020244113.1| pentatricopeptide repeat-containing protein At3g22690 [Asparagus officinalis] gb|ONK60467.1| uncharacterized protein A4U43_C08F18800 [Asparagus officinalis] Length = 842 Score = 84.3 bits (207), Expect = 2e-16 Identities = 60/112 (53%), Positives = 68/112 (60%), Gaps = 6/112 (5%) Frame = -1 Query: 319 AATISPSPSLRSQT---HQPIPXXXXXXTKSPT---ESLKLAATTDQIKQIHAHITRTXX 158 A TISPSPSL S HQP T +PT +LKLA T DQIKQ HAH+TRT Sbjct: 3 ATTISPSPSLLSSHAHHHQP------SSTHNPTTTISALKLATTIDQIKQTHAHLTRTSP 56 Query: 157 XXXXXXXXLVAAYSRLAAPLSLRYALASFRLSESAELELDPDPRTALFMLNS 2 L AAYS+L+ PL L YAL SF+LS+ A L LDP+P ALF LNS Sbjct: 57 SLSPLLPSLTAAYSKLSTPLGLHYALNSFQLSD-AHLGLDPNP--ALFALNS 105