BLASTX nr result
ID: Ophiopogon27_contig00025364
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00025364 (517 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020270229.1| probable polyamine oxidase 2 isoform X1 [Asp... 86 2e-16 gb|OAY75003.1| putative polyamine oxidase 2 [Ananas comosus] 49 1e-08 ref|XP_008787574.1| PREDICTED: probable polyamine oxidase 2 [Pho... 62 4e-08 ref|XP_010909649.1| PREDICTED: probable polyamine oxidase 2 [Ela... 61 9e-08 >ref|XP_020270229.1| probable polyamine oxidase 2 isoform X1 [Asparagus officinalis] gb|ONK67323.1| uncharacterized protein A4U43_C06F18950 [Asparagus officinalis] Length = 491 Score = 86.3 bits (212), Expect = 2e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -1 Query: 145 MESRCNSNDSLEKASYCSAIERKPSLSPSAIVIGSGFAGLAAAHALQ 5 MESRCNSNDSL+KASYCS +ERKP+ PSAIVIGSGFAGLAAAHALQ Sbjct: 1 MESRCNSNDSLDKASYCSTVERKPTSPPSAIVIGSGFAGLAAAHALQ 47 >gb|OAY75003.1| putative polyamine oxidase 2 [Ananas comosus] Length = 512 Score = 48.5 bits (114), Expect(2) = 1e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 109 KASYCSAIERKPSLSPSAIVIGSGFAGLAAAHALQ 5 + SY S +ERK S+SPSAIVIG GFAG+AAAHAL+ Sbjct: 39 RRSYFSNVERK-SISPSAIVIGGGFAGIAAAHALR 72 Score = 38.5 bits (88), Expect(2) = 1e-08 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 278 MSCFVNLGFSTNSNHFITCLL 216 M+ FVNLG ++NSNHFITCLL Sbjct: 1 MNWFVNLGLNSNSNHFITCLL 21 >ref|XP_008787574.1| PREDICTED: probable polyamine oxidase 2 [Phoenix dactylifera] Length = 490 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = -1 Query: 145 MESRCNSNDSLEKASYCSAIERKPSLSPSAIVIGSGFAGLAAAHALQ 5 ME+RCN N L+K SY S +ER+ LSPSAIVIG+GFAG+AAAHAL+ Sbjct: 1 MENRCN-NLPLKKVSYLSDVERRKPLSPSAIVIGAGFAGIAAAHALK 46 >ref|XP_010909649.1| PREDICTED: probable polyamine oxidase 2 [Elaeis guineensis] Length = 489 Score = 61.2 bits (147), Expect = 9e-08 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -1 Query: 145 MESRCNSNDSLEKASYCSAIERKPSLSPSAIVIGSGFAGLAAAHALQ 5 MESRCN N L+K SY S +ER+ SLSPSAIVIG+GFAG+AAAHAL+ Sbjct: 1 MESRCN-NLPLKKVSY-SNVERRKSLSPSAIVIGAGFAGIAAAHALK 45