BLASTX nr result
ID: Ophiopogon27_contig00024639
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00024639 (490 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264629.1| putative serine/threonine-protein kinase iso... 60 2e-07 ref|XP_020264628.1| putative receptor-like protein kinase At4g00... 60 2e-07 ref|XP_020264627.1| putative receptor-like protein kinase At4g00... 60 2e-07 >ref|XP_020264629.1| putative serine/threonine-protein kinase isoform X3 [Asparagus officinalis] Length = 383 Score = 59.7 bits (143), Expect = 2e-07 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -2 Query: 489 ILSWESASELHPSPM-WDSNSFPPPTDKSQESSSEVLPPLLRKFITFPKSAE 337 + SWES SE HPSPM DS SFP TDKS ES S LP LLRKF +FP++ E Sbjct: 331 MFSWESLSEQHPSPMRSDSTSFPQATDKSLESESN-LPSLLRKFTSFPQTDE 381 >ref|XP_020264628.1| putative receptor-like protein kinase At4g00960 isoform X2 [Asparagus officinalis] Length = 441 Score = 59.7 bits (143), Expect = 2e-07 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -2 Query: 489 ILSWESASELHPSPM-WDSNSFPPPTDKSQESSSEVLPPLLRKFITFPKSAE 337 + SWES SE HPSPM DS SFP TDKS ES S LP LLRKF +FP++ E Sbjct: 389 MFSWESLSEQHPSPMRSDSTSFPQATDKSLESESN-LPSLLRKFTSFPQTDE 439 >ref|XP_020264627.1| putative receptor-like protein kinase At4g00960 isoform X1 [Asparagus officinalis] gb|ONK69562.1| uncharacterized protein A4U43_C05F24280 [Asparagus officinalis] Length = 447 Score = 59.7 bits (143), Expect = 2e-07 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -2 Query: 489 ILSWESASELHPSPM-WDSNSFPPPTDKSQESSSEVLPPLLRKFITFPKSAE 337 + SWES SE HPSPM DS SFP TDKS ES S LP LLRKF +FP++ E Sbjct: 395 MFSWESLSEQHPSPMRSDSTSFPQATDKSLESESN-LPSLLRKFTSFPQTDE 445