BLASTX nr result
ID: Ophiopogon27_contig00024494
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00024494 (469 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK79349.1| uncharacterized protein A4U43_C01F5460 [Asparagus... 57 2e-06 ref|XP_020253210.1| cell division control protein 48 homolog C-l... 57 3e-06 ref|XP_020274402.1| cell division control protein 48 homolog C-l... 57 3e-06 >gb|ONK79349.1| uncharacterized protein A4U43_C01F5460 [Asparagus officinalis] Length = 293 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = -2 Query: 447 NGSSYAKEVVIETTHLEKALVKIPRSVSEKQKLYYETLSKNYR 319 + SS+ + +VIET+H EKALVK+ SVSEKQ++YYE LS+++R Sbjct: 249 DNSSFTRPLVIETSHFEKALVKVGPSVSEKQRIYYEALSRSHR 291 >ref|XP_020253210.1| cell division control protein 48 homolog C-like [Asparagus officinalis] Length = 781 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = -2 Query: 447 NGSSYAKEVVIETTHLEKALVKIPRSVSEKQKLYYETLSKNYR 319 + SS+ + +VIET+H EKALVK+ SVSEKQ++YYE LS+++R Sbjct: 737 DNSSFTRPLVIETSHFEKALVKVGPSVSEKQRIYYEALSRSHR 779 >ref|XP_020274402.1| cell division control protein 48 homolog C-like [Asparagus officinalis] Length = 789 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = -2 Query: 447 NGSSYAKEVVIETTHLEKALVKIPRSVSEKQKLYYETLSKNYR 319 + SS+ + +VIET+H EKALVK+ SVSEKQ++YYE LS+++R Sbjct: 745 DSSSFTRPLVIETSHFEKALVKVGPSVSEKQRIYYEALSRSHR 787