BLASTX nr result
ID: Ophiopogon27_contig00024432
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00024432 (932 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KQK20681.1| hypothetical protein BRADI_1g63372v3 [Brachypodiu... 83 1e-16 gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 76 4e-14 gb|OEL35491.1| hypothetical protein BAE44_0003490 [Dichanthelium... 60 1e-08 >gb|KQK20681.1| hypothetical protein BRADI_1g63372v3 [Brachypodium distachyon] Length = 59 Score = 82.8 bits (203), Expect = 1e-16 Identities = 40/48 (83%), Positives = 41/48 (85%) Frame = +3 Query: 3 GIEPASLAWKARGYSRR*LIIFNVSNSKPNMKFWFHSAPLWRIDVLKI 146 GIEPASLAWKARGYSRR LII+NVSNSKPNMKF FHSAPLW L I Sbjct: 6 GIEPASLAWKARGYSRRWLIIYNVSNSKPNMKFSFHSAPLWIFSPLNI 53 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 76.3 bits (186), Expect = 4e-14 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +3 Query: 3 GIEPASLAWKARGYSRR*LIIFNVSNSKPNMKFWFHSAPLWR 128 GIEPASLAWKA+GYSRR +VSNSKPNMK WFHSAPLWR Sbjct: 16 GIEPASLAWKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57 >gb|OEL35491.1| hypothetical protein BAE44_0003490 [Dichanthelium oligosanthes] Length = 51 Score = 60.5 bits (145), Expect = 1e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +3 Query: 3 GIEPASLAWKARGYSRR*LIIFNVSNSKPNMKF 101 GIEP LAWKARGYS R LIIFNVSNSKPNMKF Sbjct: 19 GIEPTLLAWKARGYSGRWLIIFNVSNSKPNMKF 51