BLASTX nr result
ID: Ophiopogon27_contig00024139
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00024139 (477 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247018.1| uncharacterized protein LOC109824784 isoform... 56 4e-06 >ref|XP_020247018.1| uncharacterized protein LOC109824784 isoform X2 [Asparagus officinalis] Length = 668 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +2 Query: 2 LDSPGTED-LNTSKEEIRTNVLIQSVQELLPEMSKSCLERVKKLVD 136 LDS G ED LN SKEE T VLIQSV+ELLP+M K +ERVKKL++ Sbjct: 621 LDSSGIEDSLNGSKEETGTEVLIQSVKELLPDMPKRSIERVKKLME 666