BLASTX nr result
ID: Ophiopogon27_contig00024100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00024100 (716 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU63300.1| Anaphase-promoting complex subunit 6 [Dendrobium ... 55 5e-06 >gb|PKU63300.1| Anaphase-promoting complex subunit 6 [Dendrobium catenatum] Length = 138 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 3/32 (9%) Frame = +2 Query: 2 VDEHGNVN---DCSAMYLDKDGEDHEINVTVI 88 VDEHGNVN DCS MYLDKDGEDHEINV V+ Sbjct: 100 VDEHGNVNSPKDCSPMYLDKDGEDHEINVRVL 131