BLASTX nr result
ID: Ophiopogon27_contig00024054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00024054 (940 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD59438.1| Rps16 protein, partial (plastid) [Clivia gardenii] 87 3e-20 emb|CAD59435.1| Rps16 protein, partial (plastid) [Clivia nobilis] 60 1e-08 ref|YP_009175987.1| ribosomal protein S16 (chloroplast) [Ficus r... 59 3e-07 emb|CAD59436.1| Rps16 protein, partial (plastid) [Clivia mirabilis] 56 3e-07 >emb|CAD59438.1| Rps16 protein, partial (plastid) [Clivia gardenii] Length = 74 Score = 87.4 bits (215), Expect(2) = 3e-20 Identities = 46/51 (90%), Positives = 47/51 (92%), Gaps = 2/51 (3%) Frame = -1 Query: 787 GIVHNGARTKSIDSFIEGKNLGLVTINKLDQLCKYILNI--EIEG*KFEQV 641 GIVH+GARTKSIDSFI GKNLGLVTINKLDQLCKYILNI EIEG KFEQV Sbjct: 24 GIVHDGARTKSIDSFIGGKNLGLVTINKLDQLCKYILNIEMEIEGLKFEQV 74 Score = 40.4 bits (93), Expect(2) = 3e-20 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 845 IDIVCSVLARNLICVGLVNR 786 IDIVCSV ARNLICVGLVNR Sbjct: 3 IDIVCSVPARNLICVGLVNR 22 >emb|CAD59435.1| Rps16 protein, partial (plastid) [Clivia nobilis] Length = 29 Score = 60.5 bits (145), Expect = 1e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -2 Query: 903 MIRCGFLHPPFSTGMKMLLNRHSLFCSC 820 +IRCGFL+PPFS GMKMLLNRHSLFCSC Sbjct: 2 LIRCGFLYPPFSIGMKMLLNRHSLFCSC 29 >ref|YP_009175987.1| ribosomal protein S16 (chloroplast) [Ficus racemosa] ref|YP_009390539.1| ribosomal protein S16 (chloroplast) [Ficus carica] gb|ALI30688.1| ribosomal protein S16 (chloroplast) [Ficus racemosa] gb|ARV87002.1| ribosomal protein S16 (chloroplast) [Ficus carica] Length = 117 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 784 IVHNGARTKSIDSFIEGKNLGLVTINKLDQLCKYILNIEI 665 I+H+GAR + IDSF GKNLGLV+INKL QLCK I +IEI Sbjct: 4 IIHDGARAERIDSFFGGKNLGLVSINKLRQLCKSIFDIEI 43 >emb|CAD59436.1| Rps16 protein, partial (plastid) [Clivia mirabilis] Length = 25 Score = 56.2 bits (134), Expect = 3e-07 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 894 CGFLHPPFSTGMKMLLNRHSLFCSC 820 CGFL+PPFS GMKMLLNRHSLFCSC Sbjct: 1 CGFLYPPFSIGMKMLLNRHSLFCSC 25