BLASTX nr result
ID: Ophiopogon27_contig00023991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00023991 (486 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272873.1| alpha-amylase 3, chloroplastic-like [Asparag... 58 1e-06 >ref|XP_020272873.1| alpha-amylase 3, chloroplastic-like [Asparagus officinalis] gb|ONK64720.1| uncharacterized protein A4U43_C07F29170 [Asparagus officinalis] Length = 940 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +2 Query: 320 RKYLFVNHNYGAFLVKLRAIAGNPGETEITDDENPFSPELEQAKIAL 460 RK LF+N+ YG+ VK +AI G+ G+ E+ +D NP S ELEQAKIAL Sbjct: 38 RKCLFINNGYGSLPVKFQAITGDSGDPELIEDGNPLSSELEQAKIAL 84