BLASTX nr result
ID: Ophiopogon27_contig00023819
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00023819 (353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB20714.1| ABC transporter A family member 2 [Morus notabilis] 59 9e-08 >gb|EXB20714.1| ABC transporter A family member 2 [Morus notabilis] Length = 856 Score = 59.3 bits (142), Expect = 9e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 165 DQSGLCYNCRNSTHQWSHMLIQLNDMDHDVDV 70 DQSGL YN RNSTHQWS M IQLNDMDHDV+V Sbjct: 825 DQSGLRYNYRNSTHQWSRMPIQLNDMDHDVNV 856