BLASTX nr result
ID: Ophiopogon27_contig00023811
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00023811 (884 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO81056.1| hypothetical protein CISIN_1g0039772mg, partial [... 65 2e-08 gb|KDO81055.1| hypothetical protein CISIN_1g0039772mg, partial [... 65 3e-08 ref|XP_009759758.1| PREDICTED: isoamylase 3, chloroplastic-like ... 64 4e-08 gb|KDO81054.1| hypothetical protein CISIN_1g0039772mg, partial [... 65 5e-08 gb|KDO81053.1| hypothetical protein CISIN_1g0039772mg, partial [... 65 6e-08 ref|XP_024039972.1| isoamylase 3, chloroplastic isoform X2 [Citr... 65 6e-08 gb|ESR47156.1| hypothetical protein CICLE_v10000347mg [Citrus cl... 65 7e-08 dbj|GAY41555.1| hypothetical protein CUMW_060400 [Citrus unshiu] 65 7e-08 ref|XP_006472546.1| PREDICTED: isoamylase 3, chloroplastic [Citr... 65 7e-08 ref|XP_006433917.1| isoamylase 3, chloroplastic isoform X1 [Citr... 65 7e-08 dbj|GAY41554.1| hypothetical protein CUMW_060400 [Citrus unshiu] 65 7e-08 ref|XP_016435743.1| PREDICTED: isoamylase 3, chloroplastic-like ... 64 1e-07 ref|XP_009627130.2| PREDICTED: isoamylase 3, chloroplastic-like ... 64 1e-07 ref|XP_016578859.1| PREDICTED: isoamylase 3, chloroplastic-like ... 64 1e-07 gb|PHU11726.1| Isoamylase 3, chloroplastic, partial [Capsicum ch... 64 1e-07 ref|XP_019231256.1| PREDICTED: isoamylase 3, chloroplastic isofo... 64 2e-07 ref|XP_006397220.1| isoamylase 3, chloroplastic isoform X3 [Eutr... 64 2e-07 ref|XP_010421826.1| PREDICTED: isoamylase 3, chloroplastic isofo... 64 2e-07 emb|CAB78026.1| isoamylase-like protein [Arabidopsis thaliana] 64 2e-07 ref|XP_016446886.1| PREDICTED: isoamylase 3, chloroplastic isofo... 64 2e-07 >gb|KDO81056.1| hypothetical protein CISIN_1g0039772mg, partial [Citrus sinensis] Length = 231 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKD++L+RCKIIAEP DCR LYLV KFPNWDR Sbjct: 160 AIAKDAILSRCKIIAEPWDCRGLYLVGKFPNWDR 193 >gb|KDO81055.1| hypothetical protein CISIN_1g0039772mg, partial [Citrus sinensis] Length = 281 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKD++L+RCKIIAEP DCR LYLV KFPNWDR Sbjct: 210 AIAKDAILSRCKIIAEPWDCRGLYLVGKFPNWDR 243 >ref|XP_009759758.1| PREDICTED: isoamylase 3, chloroplastic-like [Nicotiana sylvestris] Length = 236 Score = 63.5 bits (153), Expect = 4e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKDSVL+RCKIIAEP DC LYLV KFPNWDR Sbjct: 72 AIAKDSVLSRCKIIAEPWDCGGLYLVGKFPNWDR 105 >gb|KDO81054.1| hypothetical protein CISIN_1g0039772mg, partial [Citrus sinensis] Length = 389 Score = 64.7 bits (156), Expect = 5e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKD++L+RCKIIAEP DCR LYLV KFPNWDR Sbjct: 318 AIAKDAILSRCKIIAEPWDCRGLYLVGKFPNWDR 351 >gb|KDO81053.1| hypothetical protein CISIN_1g0039772mg, partial [Citrus sinensis] Length = 540 Score = 64.7 bits (156), Expect = 6e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKD++L+RCKIIAEP DCR LYLV KFPNWDR Sbjct: 469 AIAKDAILSRCKIIAEPWDCRGLYLVGKFPNWDR 502 >ref|XP_024039972.1| isoamylase 3, chloroplastic isoform X2 [Citrus clementina] Length = 674 Score = 64.7 bits (156), Expect = 6e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKD++L+RCKIIAEP DCR LYLV KFPNWDR Sbjct: 361 AIAKDAILSRCKIIAEPWDCRGLYLVGKFPNWDR 394 >gb|ESR47156.1| hypothetical protein CICLE_v10000347mg [Citrus clementina] Length = 704 Score = 64.7 bits (156), Expect = 7e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKD++L+RCKIIAEP DCR LYLV KFPNWDR Sbjct: 469 AIAKDAILSRCKIIAEPWDCRGLYLVGKFPNWDR 502 >dbj|GAY41555.1| hypothetical protein CUMW_060400 [Citrus unshiu] Length = 736 Score = 64.7 bits (156), Expect = 7e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKD++L+RCKIIAEP DCR LYLV KFPNWDR Sbjct: 423 AIAKDAILSRCKIIAEPWDCRGLYLVGKFPNWDR 456 >ref|XP_006472546.1| PREDICTED: isoamylase 3, chloroplastic [Citrus sinensis] Length = 782 Score = 64.7 bits (156), Expect = 7e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKD++L+RCKIIAEP DCR LYLV KFPNWDR Sbjct: 469 AIAKDAILSRCKIIAEPWDCRGLYLVGKFPNWDR 502 >ref|XP_006433917.1| isoamylase 3, chloroplastic isoform X1 [Citrus clementina] gb|ESR47157.1| hypothetical protein CICLE_v10000347mg [Citrus clementina] Length = 782 Score = 64.7 bits (156), Expect = 7e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKD++L+RCKIIAEP DCR LYLV KFPNWDR Sbjct: 469 AIAKDAILSRCKIIAEPWDCRGLYLVGKFPNWDR 502 >dbj|GAY41554.1| hypothetical protein CUMW_060400 [Citrus unshiu] Length = 797 Score = 64.7 bits (156), Expect = 7e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKD++L+RCKIIAEP DCR LYLV KFPNWDR Sbjct: 484 AIAKDAILSRCKIIAEPWDCRGLYLVGKFPNWDR 517 >ref|XP_016435743.1| PREDICTED: isoamylase 3, chloroplastic-like [Nicotiana tabacum] Length = 399 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKDSVL+RCKIIAEP DC LYLV KFPNWDR Sbjct: 341 AIAKDSVLSRCKIIAEPWDCGGLYLVGKFPNWDR 374 >ref|XP_009627130.2| PREDICTED: isoamylase 3, chloroplastic-like [Nicotiana tomentosiformis] Length = 410 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKDSVL+RCKIIAEP DC LYLV KFPNWDR Sbjct: 341 AIAKDSVLSRCKIIAEPWDCGGLYLVGKFPNWDR 374 >ref|XP_016578859.1| PREDICTED: isoamylase 3, chloroplastic-like [Capsicum annuum] Length = 550 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKDSVL+RCKIIAEP DC LYLV KFPNWDR Sbjct: 452 AIAKDSVLSRCKIIAEPWDCGGLYLVGKFPNWDR 485 >gb|PHU11726.1| Isoamylase 3, chloroplastic, partial [Capsicum chinense] Length = 578 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKDSVL+RCKIIAEP DC LYLV KFPNWDR Sbjct: 452 AIAKDSVLSRCKIIAEPWDCGGLYLVGKFPNWDR 485 >ref|XP_019231256.1| PREDICTED: isoamylase 3, chloroplastic isoform X2 [Nicotiana attenuata] Length = 684 Score = 63.5 bits (153), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKDSVL+RCKIIAEP DC LYLV KFPNWDR Sbjct: 370 AIAKDSVLSRCKIIAEPWDCGGLYLVGKFPNWDR 403 >ref|XP_006397220.1| isoamylase 3, chloroplastic isoform X3 [Eutrema salsugineum] ref|XP_024009865.1| isoamylase 3, chloroplastic isoform X3 [Eutrema salsugineum] ref|XP_024009866.1| isoamylase 3, chloroplastic isoform X3 [Eutrema salsugineum] gb|ESQ38673.1| hypothetical protein EUTSA_v10028452mg [Eutrema salsugineum] Length = 687 Score = 63.5 bits (153), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKDSVL+RCKIIAEP DC LYLV KFPNWDR Sbjct: 373 AIAKDSVLSRCKIIAEPWDCGGLYLVGKFPNWDR 406 >ref|XP_010421826.1| PREDICTED: isoamylase 3, chloroplastic isoform X2 [Camelina sativa] ref|XP_019084033.1| PREDICTED: isoamylase 3, chloroplastic isoform X2 [Camelina sativa] Length = 690 Score = 63.5 bits (153), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKDSVL+RCKIIAEP DC LYLV KFPNWDR Sbjct: 376 AIAKDSVLSRCKIIAEPWDCGGLYLVGKFPNWDR 409 >emb|CAB78026.1| isoamylase-like protein [Arabidopsis thaliana] Length = 702 Score = 63.5 bits (153), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKDSVL+RCKIIAEP DC LYLV KFPNWDR Sbjct: 388 AIAKDSVLSRCKIIAEPWDCGGLYLVGKFPNWDR 421 >ref|XP_016446886.1| PREDICTED: isoamylase 3, chloroplastic isoform X2 [Nicotiana tabacum] Length = 736 Score = 63.5 bits (153), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 388 AIAKDSVLARCKIIAEPCDCRSLYLVWKFPNWDR 489 AIAKDSVL+RCKIIAEP DC LYLV KFPNWDR Sbjct: 453 AIAKDSVLSRCKIIAEPWDCGGLYLVGKFPNWDR 486