BLASTX nr result
ID: Ophiopogon27_contig00023631
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00023631 (741 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008353200.1| PREDICTED: syntaxin-22-like [Malus domestica... 56 1e-06 >ref|XP_008353200.1| PREDICTED: syntaxin-22-like [Malus domestica] ref|XP_008353201.1| PREDICTED: syntaxin-22-like [Malus domestica] Length = 121 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/55 (56%), Positives = 38/55 (69%) Frame = -3 Query: 193 LSLFPPLLCNRQ*VWLLDNVVIFNEAIIDEREQGIQEVQQQLVWCRKSSKTLLIM 29 +SL LC RQ V LLDN + FNEAII+EREQGIQE+QQQ+ + K L I+ Sbjct: 4 ISLVISELCCRQEVLLLDNEIAFNEAIIEEREQGIQEIQQQIGEVNEIFKDLAIL 58