BLASTX nr result
ID: Ophiopogon27_contig00023445
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00023445 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65295.1| uncharacterized protein A4U43_C07F35660 [Asparagu... 71 2e-11 ref|XP_020272712.1| threonine dehydratase biosynthetic, chloropl... 71 2e-11 ref|XP_009412484.1| PREDICTED: threonine dehydratase biosyntheti... 69 8e-11 ref|XP_020257241.1| LOW QUALITY PROTEIN: threonine dehydratase b... 67 5e-10 ref|XP_020098411.1| threonine dehydratase biosynthetic, chloropl... 66 9e-10 gb|OAY81639.1| Threonine dehydratase biosynthetic, chloroplastic... 66 9e-10 ref|XP_010923370.1| PREDICTED: threonine dehydratase biosyntheti... 65 2e-09 ref|XP_020578960.1| threonine dehydratase biosynthetic, chloropl... 64 8e-09 ref|XP_016499616.1| PREDICTED: threonine dehydratase biosyntheti... 61 7e-08 ref|XP_009774928.1| PREDICTED: threonine dehydratase biosyntheti... 61 7e-08 ref|XP_019234171.1| PREDICTED: threonine dehydratase biosyntheti... 61 7e-08 ref|XP_010933388.1| PREDICTED: threonine dehydratase biosyntheti... 60 9e-08 ref|XP_008796630.1| PREDICTED: threonine dehydratase biosyntheti... 59 2e-07 ref|XP_009593672.1| PREDICTED: threonine dehydratase biosyntheti... 59 3e-07 gb|PHU05576.1| Threonine dehydratase biosynthetic, chloroplastic... 59 4e-07 gb|PHT36808.1| Threonine dehydratase biosynthetic, chloroplastic... 59 4e-07 ref|XP_018674165.1| PREDICTED: threonine dehydratase biosyntheti... 58 6e-07 gb|OIS98035.1| threonine dehydratase biosynthetic, chloroplastic... 58 6e-07 ref|XP_019254717.1| PREDICTED: threonine dehydratase biosyntheti... 58 6e-07 ref|XP_016455948.1| PREDICTED: threonine dehydratase biosyntheti... 58 6e-07 >gb|ONK65295.1| uncharacterized protein A4U43_C07F35660 [Asparagus officinalis] Length = 446 Score = 71.2 bits (173), Expect = 2e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLM 120 NVLVGIQVPD E+ EFQNQAK+LGYEYA+EM NEAF+LLM Sbjct: 406 NVLVGIQVPDEEMEEFQNQAKDLGYEYAFEMNNEAFKLLM 445 >ref|XP_020272712.1| threonine dehydratase biosynthetic, chloroplastic-like [Asparagus officinalis] Length = 720 Score = 71.2 bits (173), Expect = 2e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLM 120 NVLVGIQVPD E+ EFQNQAK+LGYEYA+EM NEAF+LLM Sbjct: 680 NVLVGIQVPDEEMEEFQNQAKDLGYEYAFEMNNEAFKLLM 719 >ref|XP_009412484.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 621 Score = 69.3 bits (168), Expect = 8e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLMQ 123 NVLVGIQVP GE EF+N+A+NLGYEYAYEM N A+RLLMQ Sbjct: 581 NVLVGIQVPKGETEEFKNRAQNLGYEYAYEMNNAAYRLLMQ 621 >ref|XP_020257241.1| LOW QUALITY PROTEIN: threonine dehydratase biosynthetic, chloroplastic-like [Asparagus officinalis] Length = 615 Score = 67.0 bits (162), Expect = 5e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLM 120 NVLVGIQVPD E+ EF+NQAK LGYEYA EM NEAFRLLM Sbjct: 575 NVLVGIQVPDEEMEEFRNQAKCLGYEYADEMNNEAFRLLM 614 >ref|XP_020098411.1| threonine dehydratase biosynthetic, chloroplastic [Ananas comosus] Length = 610 Score = 66.2 bits (160), Expect = 9e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLMQ 123 NVLVGIQVP E++EF+NQA+NLGYEY EM NEA+RLLMQ Sbjct: 570 NVLVGIQVPKEEMDEFKNQAENLGYEYTSEMNNEAYRLLMQ 610 >gb|OAY81639.1| Threonine dehydratase biosynthetic, chloroplastic [Ananas comosus] Length = 649 Score = 66.2 bits (160), Expect = 9e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLMQ 123 NVLVGIQVP E++EF+NQA+NLGYEY EM NEA+RLLMQ Sbjct: 609 NVLVGIQVPKEEMDEFKNQAENLGYEYTSEMNNEAYRLLMQ 649 >ref|XP_010923370.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Elaeis guineensis] Length = 300 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLMQ 123 NVLVGIQVP ++ EF+N+A NLGYEYAYE+ NEA++LLMQ Sbjct: 260 NVLVGIQVPKEDMEEFRNKANNLGYEYAYEVTNEAYKLLMQ 300 >ref|XP_020578960.1| threonine dehydratase biosynthetic, chloroplastic [Phalaenopsis equestris] Length = 616 Score = 63.5 bits (153), Expect = 8e-09 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLMQ 123 NVLVG+QVP ++ EF NQA LGYEY YEM NEA+RLLMQ Sbjct: 576 NVLVGLQVPSEDMVEFSNQANKLGYEYTYEMNNEAYRLLMQ 616 >ref|XP_016499616.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Nicotiana tabacum] Length = 602 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLMQ 123 NVLVGIQVP E++EFQ +A +LGYEYA E NEAF+L+MQ Sbjct: 562 NVLVGIQVPQAEVDEFQGRADSLGYEYAVESLNEAFQLIMQ 602 >ref|XP_009774928.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic [Nicotiana sylvestris] Length = 602 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLMQ 123 NVLVGIQVP E++EFQ +A +LGYEYA E NEAF+L+MQ Sbjct: 562 NVLVGIQVPQAEVDEFQGRADSLGYEYAVESLNEAFQLIMQ 602 >ref|XP_019234171.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Nicotiana attenuata] gb|OIT26911.1| threonine dehydratase biosynthetic, chloroplastic [Nicotiana attenuata] Length = 607 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLMQ 123 NVLVGIQVP E++EFQ +A +LGYEYA E NEAF+L+MQ Sbjct: 567 NVLVGIQVPQAEVDEFQGRADSLGYEYAVESLNEAFQLIMQ 607 >ref|XP_010933388.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic [Elaeis guineensis] Length = 617 Score = 60.5 bits (145), Expect = 9e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLMQ 123 NVLVGIQVP+ ++ EF QA NLGYEY YE+ +E +RLLMQ Sbjct: 577 NVLVGIQVPEEDMEEFTKQANNLGYEYTYEVTDEVYRLLMQ 617 >ref|XP_008796630.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Phoenix dactylifera] Length = 615 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLMQ 123 NVLVGIQVP ++ EF+N+A LGYEYAY + NEA++LLMQ Sbjct: 575 NVLVGIQVPKEDMEEFRNKANTLGYEYAYGVTNEAYQLLMQ 615 >ref|XP_009593672.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic [Nicotiana tomentosiformis] ref|XP_016484011.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Nicotiana tabacum] Length = 605 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLM 120 NVLVGIQVP E++EFQ +A +LGYEYA E NEAF+L+M Sbjct: 565 NVLVGIQVPQAEVDEFQGRADSLGYEYAMESLNEAFQLIM 604 >gb|PHU05576.1| Threonine dehydratase biosynthetic, chloroplastic [Capsicum chinense] Length = 584 Score = 58.5 bits (140), Expect = 4e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLM 120 NVLVGIQVP EI+EFQ +A LGYEYA E NEAF+L+M Sbjct: 544 NVLVGIQVPQDEIDEFQGRADTLGYEYAVESLNEAFQLIM 583 >gb|PHT36808.1| Threonine dehydratase biosynthetic, chloroplastic [Capsicum baccatum] Length = 584 Score = 58.5 bits (140), Expect = 4e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLM 120 NVLVGIQVP EI+EFQ +A LGYEYA E NEAF+L+M Sbjct: 544 NVLVGIQVPQDEIDEFQGRADTLGYEYAVESLNEAFQLIM 583 >ref|XP_018674165.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic isoform X2 [Musa acuminata subsp. malaccensis] Length = 549 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLMQ 123 NVLVGIQV ++ EF+ A+NLGYE+ YEM NEA+RLLMQ Sbjct: 509 NVLVGIQVSKADMKEFKIGAQNLGYEFTYEMNNEAYRLLMQ 549 >gb|OIS98035.1| threonine dehydratase biosynthetic, chloroplastic [Nicotiana attenuata] Length = 566 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLM 120 NVLVGIQVP+ E +EFQ +A NLGYEY E N+AF+L+M Sbjct: 526 NVLVGIQVPEAEFDEFQGRAANLGYEYVVESLNDAFKLIM 565 >ref|XP_019254717.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Nicotiana attenuata] Length = 603 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLM 120 NVLVGIQVP+ E +EFQ +A NLGYEY E N+AF+L+M Sbjct: 563 NVLVGIQVPEAEFDEFQGRAANLGYEYVVESLNDAFKLIM 602 >ref|XP_016455948.1| PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Nicotiana tabacum] Length = 603 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 1 NVLVGIQVPDGEINEFQNQAKNLGYEYAYEMKNEAFRLLM 120 NVLVGIQVP+ E +EFQ +A NLGYEY E N+AF+L+M Sbjct: 563 NVLVGIQVPEAEFDEFQGRAANLGYEYVVESLNDAFKLIM 602