BLASTX nr result
ID: Ophiopogon27_contig00023339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00023339 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241343.1| putative clathrin assembly protein At2g25430... 67 6e-10 ref|XP_008784532.1| PREDICTED: putative clathrin assembly protei... 60 8e-08 ref|XP_008810593.1| PREDICTED: putative clathrin assembly protei... 60 1e-07 ref|XP_010937786.2| PREDICTED: putative clathrin assembly protei... 57 9e-07 gb|PKA63189.1| Putative clathrin assembly protein [Apostasia she... 57 2e-06 >ref|XP_020241343.1| putative clathrin assembly protein At2g25430 [Asparagus officinalis] ref|XP_020241344.1| putative clathrin assembly protein At2g25430 [Asparagus officinalis] gb|ONK59520.1| uncharacterized protein A4U43_C08F7270 [Asparagus officinalis] Length = 634 Score = 66.6 bits (161), Expect = 6e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 ARNGMQGQASLARIDNSYGYPNPAMPYGMPPVHGTG 110 ARNGMQGQ SLAR++NSY Y NPAMPYGMPPV+G G Sbjct: 592 ARNGMQGQTSLARLENSYTYLNPAMPYGMPPVYGNG 627 >ref|XP_008784532.1| PREDICTED: putative clathrin assembly protein At2g25430 [Phoenix dactylifera] Length = 640 Score = 60.5 bits (145), Expect = 8e-08 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +3 Query: 3 ARNGMQGQASLARIDNSYGYPNPAMPYGMPPVHGTGAG 116 A++GMQGQASLA+++NSY +PNPAMPYGMP + G G Sbjct: 599 AKDGMQGQASLAKLNNSYNFPNPAMPYGMPAAYNGGYG 636 >ref|XP_008810593.1| PREDICTED: putative clathrin assembly protein At2g25430 [Phoenix dactylifera] ref|XP_017701875.1| PREDICTED: putative clathrin assembly protein At2g25430 [Phoenix dactylifera] Length = 630 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +3 Query: 3 ARNGMQGQASLARIDNSYGYPNPAMPYGMPPVHGTG 110 AR+GMQGQASLAR++NSY +PNPAMPYGMPP + G Sbjct: 590 ARDGMQGQASLARLNNSY-FPNPAMPYGMPPAYNGG 624 >ref|XP_010937786.2| PREDICTED: putative clathrin assembly protein At2g25430 [Elaeis guineensis] Length = 630 Score = 57.4 bits (137), Expect = 9e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 3 ARNGMQGQASLARIDNSYGYPNPAMPYGMPPVHGTG 110 +R+GMQGQASLA+++NSY +PNPAMPYGMPP + G Sbjct: 590 SRDGMQGQASLAKLNNSY-FPNPAMPYGMPPAYNGG 624 >gb|PKA63189.1| Putative clathrin assembly protein [Apostasia shenzhenica] Length = 646 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 3 ARNGMQGQASLARIDNSYGYPNPAMPYGMPPVHG 104 +++GMQGQ SLA+++N+Y YPNPAMPYGMPP G Sbjct: 607 SKDGMQGQVSLAKLNNAYIYPNPAMPYGMPPPAG 640