BLASTX nr result
ID: Ophiopogon27_contig00023310
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00023310 (355 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008800362.1| PREDICTED: protein Iojap-related, mitochondr... 52 2e-06 ref|XP_020246804.1| protein Iojap-related, mitochondrial [Aspara... 53 7e-06 >ref|XP_008800362.1| PREDICTED: protein Iojap-related, mitochondrial-like [Phoenix dactylifera] Length = 75 Score = 52.0 bits (123), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 350 EISSKAPSEDVEKTVAKTRRKNNSKKPMKSV 258 EIS K PS+D+EK + KTRR+NNSKKPMKSV Sbjct: 44 EISPKGPSQDLEKAIVKTRRRNNSKKPMKSV 74 >ref|XP_020246804.1| protein Iojap-related, mitochondrial [Asparagus officinalis] gb|ONK57971.1| uncharacterized protein A4U43_C09F6310 [Asparagus officinalis] Length = 186 Score = 52.8 bits (125), Expect = 7e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 350 EISSKAPSEDVEKTVAKTRRKNNSKKPMKSVAKS 249 E S K PS+DVE + KTRRKNNSKKPMKS AKS Sbjct: 153 EKSPKLPSQDVENAIVKTRRKNNSKKPMKSAAKS 186