BLASTX nr result
ID: Ophiopogon27_contig00023241
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00023241 (362 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB11494.1| unnamed protein product [Arabidopsis thaliana] 55 3e-07 ref|NP_201050.2| EMB514 (DUF3223) [Arabidopsis thaliana] >gi|751... 55 2e-06 ref|XP_006281035.2| protein EMBRYO DEFECTIVE 514 [Capsella rubella] 55 2e-06 ref|XP_010483956.1| PREDICTED: uncharacterized protein LOC104762... 55 2e-06 ref|XP_010444092.1| PREDICTED: uncharacterized protein LOC104726... 55 2e-06 ref|XP_010458929.1| PREDICTED: uncharacterized protein LOC104740... 55 2e-06 gb|EOA13933.1| hypothetical protein CARUB_v10027052mg, partial [... 55 2e-06 ref|XP_018489244.1| PREDICTED: uncharacterized protein LOC108859... 54 5e-06 ref|XP_020257307.1| DNA ligase 1-like [Asparagus officinalis] >g... 54 7e-06 ref|XP_020276170.1| protein DCL, chloroplastic-like [Asparagus o... 53 7e-06 ref|XP_013616549.1| PREDICTED: uncharacterized protein LOC106322... 53 8e-06 ref|XP_009130215.1| PREDICTED: uncharacterized protein LOC103855... 53 8e-06 ref|XP_013664571.1| protein EMBRYO DEFECTIVE 514 [Brassica napus... 53 9e-06 >dbj|BAB11494.1| unnamed protein product [Arabidopsis thaliana] Length = 100 Score = 54.7 bits (130), Expect = 3e-07 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 T+DDFSFRKCVDQILPLPENMK +NGN Sbjct: 46 TADDFSFRKCVDQILPLPENMKTPGANGN 74 >ref|NP_201050.2| EMB514 (DUF3223) [Arabidopsis thaliana] sp|Q8L557.1|EM514_ARATH RecName: Full=Protein EMBRYO DEFECTIVE 514; AltName: Full=Protein DOMINO 1 gb|AAM21312.1|AF371327_1 EMB514 [Arabidopsis thaliana] gb|AAM65405.1| unknown [Arabidopsis thaliana] gb|AAP40395.1| unknown protein [Arabidopsis thaliana] gb|AAP40494.1| unknown protein [Arabidopsis thaliana] dbj|BAD43068.1| unnamed protein product [Arabidopsis thaliana] dbj|BAF01556.1| hypothetical protein [Arabidopsis thaliana] gb|AED97608.1| EMB514 (DUF3223) [Arabidopsis thaliana] gb|OAO93451.1| hypothetical protein AXX17_AT5G61970 [Arabidopsis thaliana] Length = 202 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 T+DDFSFRKCVDQILPLPENMK +NGN Sbjct: 148 TADDFSFRKCVDQILPLPENMKTPGANGN 176 >ref|XP_006281035.2| protein EMBRYO DEFECTIVE 514 [Capsella rubella] Length = 203 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 T+DDFSFRKCVDQILPLPENMK +NGN Sbjct: 148 TADDFSFRKCVDQILPLPENMKTPGANGN 176 >ref|XP_010483956.1| PREDICTED: uncharacterized protein LOC104762379 [Camelina sativa] Length = 203 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 T+DDFSFRKCVDQILPLPENMK +NGN Sbjct: 148 TADDFSFRKCVDQILPLPENMKAPGANGN 176 >ref|XP_010444092.1| PREDICTED: uncharacterized protein LOC104726842 [Camelina sativa] Length = 203 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 T+DDFSFRKCVDQILPLPENMK +NGN Sbjct: 148 TADDFSFRKCVDQILPLPENMKTPGANGN 176 >ref|XP_010458929.1| PREDICTED: uncharacterized protein LOC104740096 [Camelina sativa] Length = 205 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 T+DDFSFRKCVDQILPLPENMK +NGN Sbjct: 150 TADDFSFRKCVDQILPLPENMKAPGANGN 178 >gb|EOA13933.1| hypothetical protein CARUB_v10027052mg, partial [Capsella rubella] Length = 232 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 T+DDFSFRKCVDQILPLPENMK +NGN Sbjct: 177 TADDFSFRKCVDQILPLPENMKTPGANGN 205 >ref|XP_018489244.1| PREDICTED: uncharacterized protein LOC108859832 [Raphanus sativus] Length = 200 Score = 53.5 bits (127), Expect = 5e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 T+DDFSFRKCVDQILPLPENMK S GN Sbjct: 146 TADDFSFRKCVDQILPLPENMKAPGSTGN 174 >ref|XP_020257307.1| DNA ligase 1-like [Asparagus officinalis] gb|ONK75445.1| uncharacterized protein A4U43_C03F16910 [Asparagus officinalis] Length = 259 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 +SDDFSFRKCVD+ILPLPENMKV S GN Sbjct: 201 SSDDFSFRKCVDRILPLPENMKVPASGGN 229 >ref|XP_020276170.1| protein DCL, chloroplastic-like [Asparagus officinalis] gb|ONK65261.1| uncharacterized protein A4U43_C07F35320 [Asparagus officinalis] Length = 214 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVH-PSNGNK 273 +SDDFSFRKCVD +LPLPENMK+H S+GNK Sbjct: 154 SSDDFSFRKCVDHMLPLPENMKIHSSSDGNK 184 >ref|XP_013616549.1| PREDICTED: uncharacterized protein LOC106322944 [Brassica oleracea var. oleracea] Length = 192 Score = 52.8 bits (125), Expect = 8e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 T+DDFS+RKCVD ILPLPENMK SNGN Sbjct: 139 TADDFSYRKCVDHILPLPENMKTPGSNGN 167 >ref|XP_009130215.1| PREDICTED: uncharacterized protein LOC103855007 [Brassica rapa] ref|XP_013664570.1| protein EMBRYO DEFECTIVE 514-like [Brassica napus] ref|XP_022562019.1| protein EMBRYO DEFECTIVE 514-like [Brassica napus] Length = 192 Score = 52.8 bits (125), Expect = 8e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 T+DDFS+RKCVD ILPLPENMK SNGN Sbjct: 139 TADDFSYRKCVDHILPLPENMKTPGSNGN 167 >ref|XP_013664571.1| protein EMBRYO DEFECTIVE 514 [Brassica napus] ref|XP_022562017.1| protein EMBRYO DEFECTIVE 514-like [Brassica napus] emb|CDY67519.1| BnaAnng24490D [Brassica napus] Length = 195 Score = 52.8 bits (125), Expect = 9e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -1 Query: 362 TSDDFSFRKCVDQILPLPENMKVHPSNGN 276 T+DDFS+RKCVD ILPLPENMK SNGN Sbjct: 142 TADDFSYRKCVDHILPLPENMKTPGSNGN 170