BLASTX nr result
ID: Ophiopogon27_contig00023194
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00023194 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264307.1| uncharacterized aarF domain-containing prote... 64 2e-09 >ref|XP_020264307.1| uncharacterized aarF domain-containing protein kinase 2-like [Asparagus officinalis] ref|XP_020264308.1| uncharacterized aarF domain-containing protein kinase 2-like [Asparagus officinalis] gb|ONK69317.1| uncharacterized protein A4U43_C05F21580 [Asparagus officinalis] Length = 712 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 263 WHRFLAFGKVRKVALPFLESNRSSYSRAQDHGTHSIAGFPFTCR 394 +H FLA GKVRK+ P L +NRS+YSR DHG HS+AGFP TC+ Sbjct: 4 YHWFLACGKVRKITHPLLGNNRSNYSRLHDHGKHSVAGFPSTCQ 47