BLASTX nr result
ID: Ophiopogon27_contig00023127
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00023127 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246347.1| uncharacterized CRM domain-containing protei... 60 2e-15 ref|XP_020246349.1| uncharacterized CRM domain-containing protei... 60 2e-15 ref|XP_019708564.1| PREDICTED: uncharacterized CRM domain-contai... 49 2e-11 ref|XP_019708568.1| PREDICTED: uncharacterized CRM domain-contai... 49 2e-11 ref|XP_019708570.1| PREDICTED: uncharacterized CRM domain-contai... 49 2e-11 ref|XP_017700295.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 48 9e-11 gb|EAZ31202.1| hypothetical protein OsJ_15301 [Oryza sativa Japo... 48 1e-10 ref|XP_015636442.1| PREDICTED: uncharacterized CRM domain-contai... 48 1e-10 ref|XP_015636443.1| PREDICTED: uncharacterized CRM domain-contai... 48 1e-10 dbj|BAS89860.1| Os04g0492900, partial [Oryza sativa Japonica Group] 48 1e-10 ref|XP_020574658.1| uncharacterized CRM domain-containing protei... 47 3e-10 gb|KQJ83319.1| hypothetical protein BRADI_5g14290v3 [Brachypodiu... 47 4e-10 ref|XP_010240060.1| PREDICTED: uncharacterized CRM domain-contai... 47 4e-10 gb|PNT61360.1| hypothetical protein BRADI_5g14290v3 [Brachypodiu... 47 4e-10 ref|XP_010240061.1| PREDICTED: uncharacterized CRM domain-contai... 47 4e-10 gb|OEL25154.1| putative CRM domain-containing protein [Dichanthe... 48 1e-09 ref|XP_020159336.1| uncharacterized CRM domain-containing protei... 46 2e-09 ref|XP_018678091.1| PREDICTED: uncharacterized CRM domain-contai... 46 2e-09 ref|XP_018678092.1| PREDICTED: uncharacterized CRM domain-contai... 46 2e-09 ref|XP_020159337.1| uncharacterized CRM domain-containing protei... 46 2e-09 >ref|XP_020246347.1| uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1 [Asparagus officinalis] Length = 487 Score = 59.7 bits (143), Expect(2) = 2e-15 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -1 Query: 321 DDGEEVLFAMRLCQISAASKRSDSPEND-AKVTDLDEIDKIFLRADSIE*KEK 166 DD E+V F L QISAA+KR DSPEN+ KV+DLDEID+IFLRAD + K++ Sbjct: 434 DDKEQVDFETHLRQISAAAKRGDSPENNNVKVSDLDEIDQIFLRADFLLNKKR 486 Score = 50.1 bits (118), Expect(2) = 2e-15 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 427 MSESEDLSDLFETDSDGEKMEEKEEKPLYLGT 332 +SESE LSDLFETD+D K+EEKEE PLYL T Sbjct: 394 LSESEALSDLFETDTDEGKIEEKEETPLYLNT 425 >ref|XP_020246349.1| uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X2 [Asparagus officinalis] gb|ONK57834.1| uncharacterized protein A4U43_C09F4670 [Asparagus officinalis] Length = 482 Score = 59.7 bits (143), Expect(2) = 2e-15 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -1 Query: 321 DDGEEVLFAMRLCQISAASKRSDSPEND-AKVTDLDEIDKIFLRADSIE*KEK 166 DD E+V F L QISAA+KR DSPEN+ KV+DLDEID+IFLRAD + K++ Sbjct: 429 DDKEQVDFETHLRQISAAAKRGDSPENNNVKVSDLDEIDQIFLRADFLLNKKR 481 Score = 50.1 bits (118), Expect(2) = 2e-15 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 427 MSESEDLSDLFETDSDGEKMEEKEEKPLYLGT 332 +SESE LSDLFETD+D K+EEKEE PLYL T Sbjct: 389 LSESEALSDLFETDTDEGKIEEKEETPLYLNT 420 >ref|XP_019708564.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1 [Elaeis guineensis] ref|XP_019708565.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1 [Elaeis guineensis] ref|XP_019708566.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1 [Elaeis guineensis] ref|XP_019708567.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1 [Elaeis guineensis] Length = 498 Score = 49.3 bits (116), Expect(2) = 2e-11 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -1 Query: 300 FAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 F L QI+AASK DS E D K+ DLDEIDKIFLRA S+ Sbjct: 453 FEEHLRQIAAASKIGDSLEKDVKLEDLDEIDKIFLRASSL 492 Score = 47.0 bits (110), Expect(2) = 2e-11 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYLGTSIQ**RRGSPFCNAVMPD 278 T S+SEDLSD+FETDS+GE E+K EKPLYL P N MPD Sbjct: 407 TWSDSEDLSDIFETDSEGE-TEDKLEKPLYLDAV-----ERFPSVNGGMPD 451 >ref|XP_019708568.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X2 [Elaeis guineensis] ref|XP_019708569.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X2 [Elaeis guineensis] Length = 402 Score = 49.3 bits (116), Expect(2) = 2e-11 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -1 Query: 300 FAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 F L QI+AASK DS E D K+ DLDEIDKIFLRA S+ Sbjct: 357 FEEHLRQIAAASKIGDSLEKDVKLEDLDEIDKIFLRASSL 396 Score = 47.0 bits (110), Expect(2) = 2e-11 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYLGTSIQ**RRGSPFCNAVMPD 278 T S+SEDLSD+FETDS+GE E+K EKPLYL P N MPD Sbjct: 311 TWSDSEDLSDIFETDSEGE-TEDKLEKPLYLDAV-----ERFPSVNGGMPD 355 >ref|XP_019708570.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X3 [Elaeis guineensis] Length = 382 Score = 49.3 bits (116), Expect(2) = 2e-11 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -1 Query: 300 FAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 F L QI+AASK DS E D K+ DLDEIDKIFLRA S+ Sbjct: 337 FEEHLRQIAAASKIGDSLEKDVKLEDLDEIDKIFLRASSL 376 Score = 47.0 bits (110), Expect(2) = 2e-11 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYLGTSIQ**RRGSPFCNAVMPD 278 T S+SEDLSD+FETDS+GE E+K EKPLYL P N MPD Sbjct: 291 TWSDSEDLSDIFETDSEGE-TEDKLEKPLYLDAV-----ERFPSVNGGMPD 335 >ref|XP_017700295.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized CRM domain-containing protein At3g25440, chloroplastic [Phoenix dactylifera] Length = 502 Score = 47.8 bits (112), Expect(2) = 9e-11 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = -1 Query: 300 FAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 F L QI+AASK DS E D K+ +LDEIDKIFLRA S+ Sbjct: 457 FEEHLRQIAAASKIGDSLEKDVKLEELDEIDKIFLRASSL 496 Score = 46.2 bits (108), Expect(2) = 9e-11 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 T S+SEDLSD+FETDS+GE E+K EKPLYL Sbjct: 411 TWSDSEDLSDIFETDSEGE-TEDKLEKPLYL 440 >gb|EAZ31202.1| hypothetical protein OsJ_15301 [Oryza sativa Japonica Group] Length = 484 Score = 48.1 bits (113), Expect(2) = 1e-10 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 T SESEDLSD+FETDS+ E+++E +E+PLYL Sbjct: 393 TYSESEDLSDIFETDSEEEQVQESKEQPLYL 423 Score = 45.4 bits (106), Expect(2) = 1e-10 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = -1 Query: 333 PLFSDDGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 P ++D E F L +I++ S R+DS + KV++LDEIDKIFLRA S+ Sbjct: 430 PSENNDNEPDDFEEHLRKIASLSDRTDSSAKELKVSELDEIDKIFLRASSL 480 >ref|XP_015636442.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1 [Oryza sativa Japonica Group] emb|CAD41533.1| OSJNBb0091E11.2 [Oryza sativa Japonica Group] emb|CAE02049.2| OJ990528_30.7 [Oryza sativa Japonica Group] emb|CAH67731.1| H0522A01.2 [Oryza sativa] dbj|BAF15094.1| Os04g0492900 [Oryza sativa Japonica Group] emb|CAH67539.1| H0425E08.7 [Oryza sativa] gb|EAY94663.1| hypothetical protein OsI_16441 [Oryza sativa Indica Group] dbj|BAS89858.1| Os04g0492900 [Oryza sativa Japonica Group] Length = 479 Score = 48.1 bits (113), Expect(2) = 1e-10 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 T SESEDLSD+FETDS+ E+++E +E+PLYL Sbjct: 388 TYSESEDLSDIFETDSEEEQVQESKEQPLYL 418 Score = 45.4 bits (106), Expect(2) = 1e-10 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = -1 Query: 333 PLFSDDGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 P ++D E F L +I++ S R+DS + KV++LDEIDKIFLRA S+ Sbjct: 425 PSENNDNEPDDFEEHLRKIASLSDRTDSSAKELKVSELDEIDKIFLRASSL 475 >ref|XP_015636443.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X2 [Oryza sativa Japonica Group] Length = 343 Score = 48.1 bits (113), Expect(2) = 1e-10 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 T SESEDLSD+FETDS+ E+++E +E+PLYL Sbjct: 252 TYSESEDLSDIFETDSEEEQVQESKEQPLYL 282 Score = 45.4 bits (106), Expect(2) = 1e-10 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = -1 Query: 333 PLFSDDGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 P ++D E F L +I++ S R+DS + KV++LDEIDKIFLRA S+ Sbjct: 289 PSENNDNEPDDFEEHLRKIASLSDRTDSSAKELKVSELDEIDKIFLRASSL 339 >dbj|BAS89860.1| Os04g0492900, partial [Oryza sativa Japonica Group] Length = 340 Score = 48.1 bits (113), Expect(2) = 1e-10 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 T SESEDLSD+FETDS+ E+++E +E+PLYL Sbjct: 249 TYSESEDLSDIFETDSEEEQVQESKEQPLYL 279 Score = 45.4 bits (106), Expect(2) = 1e-10 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = -1 Query: 333 PLFSDDGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 P ++D E F L +I++ S R+DS + KV++LDEIDKIFLRA S+ Sbjct: 286 PSENNDNEPDDFEEHLRKIASLSDRTDSSAKELKVSELDEIDKIFLRASSL 336 >ref|XP_020574658.1| uncharacterized CRM domain-containing protein At3g25440, chloroplastic [Phalaenopsis equestris] ref|XP_020574659.1| uncharacterized CRM domain-containing protein At3g25440, chloroplastic [Phalaenopsis equestris] Length = 512 Score = 47.0 bits (110), Expect(2) = 3e-10 Identities = 25/47 (53%), Positives = 30/47 (63%) Frame = -1 Query: 321 DDGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 DDG F L +ISAA+KR D + +LDEIDKIFLRADS+ Sbjct: 461 DDGAAEDFQEHLRRISAAAKRGGFGGKDLNIAELDEIDKIFLRADSL 507 Score = 45.1 bits (105), Expect(2) = 3e-10 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -3 Query: 424 SESEDLSDLFETDSDGEKMEEKEEKPLYL 338 SESE+LSD+FETDSDG MEEK+ +PLYL Sbjct: 424 SESENLSDIFETDSDG-GMEEKDSRPLYL 451 >gb|KQJ83319.1| hypothetical protein BRADI_5g14290v3 [Brachypodium distachyon] Length = 509 Score = 47.4 bits (111), Expect(2) = 4e-10 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = -1 Query: 324 SDDGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 S+D E F L +I++ S ++DSP + K+++LDEIDKIFLRA S+ Sbjct: 458 SNDNEPDDFEEHLRKIASLSDKTDSPAKELKISELDEIDKIFLRASSL 505 Score = 44.3 bits (103), Expect(2) = 4e-10 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 T SESEDLSD+FETDS+ E++E+ +E+PLYL Sbjct: 419 TCSESEDLSDIFETDSE-EQVEDTKERPLYL 448 >ref|XP_010240060.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1 [Brachypodium distachyon] Length = 480 Score = 47.4 bits (111), Expect(2) = 4e-10 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = -1 Query: 324 SDDGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 S+D E F L +I++ S ++DSP + K+++LDEIDKIFLRA S+ Sbjct: 429 SNDNEPDDFEEHLRKIASLSDKTDSPAKELKISELDEIDKIFLRASSL 476 Score = 44.3 bits (103), Expect(2) = 4e-10 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 T SESEDLSD+FETDS+ E++E+ +E+PLYL Sbjct: 390 TCSESEDLSDIFETDSE-EQVEDTKERPLYL 419 >gb|PNT61360.1| hypothetical protein BRADI_5g14290v3 [Brachypodium distachyon] Length = 478 Score = 47.4 bits (111), Expect(2) = 4e-10 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = -1 Query: 324 SDDGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 S+D E F L +I++ S ++DSP + K+++LDEIDKIFLRA S+ Sbjct: 427 SNDNEPDDFEEHLRKIASLSDKTDSPAKELKISELDEIDKIFLRASSL 474 Score = 44.3 bits (103), Expect(2) = 4e-10 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 T SESEDLSD+FETDS+ E++E+ +E+PLYL Sbjct: 388 TCSESEDLSDIFETDSE-EQVEDTKERPLYL 417 >ref|XP_010240061.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X2 [Brachypodium distachyon] gb|KQJ83318.1| hypothetical protein BRADI_5g14290v3 [Brachypodium distachyon] gb|PNT61359.1| hypothetical protein BRADI_5g14290v3 [Brachypodium distachyon] Length = 392 Score = 47.4 bits (111), Expect(2) = 4e-10 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = -1 Query: 324 SDDGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 S+D E F L +I++ S ++DSP + K+++LDEIDKIFLRA S+ Sbjct: 341 SNDNEPDDFEEHLRKIASLSDKTDSPAKELKISELDEIDKIFLRASSL 388 Score = 44.3 bits (103), Expect(2) = 4e-10 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 T SESEDLSD+FETDS+ E++E+ +E+PLYL Sbjct: 302 TCSESEDLSDIFETDSE-EQVEDTKERPLYL 331 >gb|OEL25154.1| putative CRM domain-containing protein [Dichanthelium oligosanthes] Length = 476 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 24/51 (47%), Positives = 35/51 (68%) Frame = -1 Query: 333 PLFSDDGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 P ++D E F L +I++ S ++DSP + KV++LDEIDKIFLRA S+ Sbjct: 422 PSENNDNEPDDFEEHLRKIASLSDKTDSPSKELKVSELDEIDKIFLRASSL 472 Score = 42.7 bits (99), Expect(2) = 1e-09 Identities = 20/31 (64%), Positives = 28/31 (90%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 + SESEDLSD+FET+S+ E+ E+K+E+PLYL Sbjct: 386 SFSESEDLSDIFETESE-EQEEDKKERPLYL 415 >ref|XP_020159336.1| uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1 [Aegilops tauschii subsp. tauschii] Length = 482 Score = 45.8 bits (107), Expect(2) = 2e-09 Identities = 22/46 (47%), Positives = 32/46 (69%) Frame = -1 Query: 318 DGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 D E F L +I++ S ++DSP + K+++LDEIDKIFLRA S+ Sbjct: 433 DNESDDFEEHLRKIASLSDKADSPAKELKISELDEIDKIFLRASSL 478 Score = 43.9 bits (102), Expect(2) = 2e-09 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 T SESEDLSD+FETDS+ E+ E+ +E+PLYL Sbjct: 392 TYSESEDLSDMFETDSE-EQAEDSKERPLYL 421 >ref|XP_018678091.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1 [Musa acuminata subsp. malaccensis] Length = 469 Score = 46.2 bits (108), Expect(2) = 2e-09 Identities = 25/46 (54%), Positives = 29/46 (63%) Frame = -1 Query: 318 DGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 D E F L QI+AASKR D D K+ DLD +DKIFLRA S+ Sbjct: 419 DEEPKDFEEHLRQIAAASKRIDLSTKDVKLADLDAVDKIFLRASSL 464 Score = 43.5 bits (101), Expect(2) = 2e-09 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 424 SESEDLSDLFETDSDGEKMEEKEEKPLYL 338 SE+EDLSD+FETDSD E M EK E+PLYL Sbjct: 381 SETEDLSDMFETDSDMEVM-EKSERPLYL 408 >ref|XP_018678092.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X2 [Musa acuminata subsp. malaccensis] Length = 465 Score = 46.2 bits (108), Expect(2) = 2e-09 Identities = 25/46 (54%), Positives = 29/46 (63%) Frame = -1 Query: 318 DGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 D E F L QI+AASKR D D K+ DLD +DKIFLRA S+ Sbjct: 415 DEEPKDFEEHLRQIAAASKRIDLSTKDVKLADLDAVDKIFLRASSL 460 Score = 43.5 bits (101), Expect(2) = 2e-09 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 424 SESEDLSDLFETDSDGEKMEEKEEKPLYL 338 SE+EDLSD+FETDSD E M EK E+PLYL Sbjct: 377 SETEDLSDMFETDSDMEVM-EKSERPLYL 404 >ref|XP_020159337.1| uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X2 [Aegilops tauschii subsp. tauschii] Length = 382 Score = 45.8 bits (107), Expect(2) = 2e-09 Identities = 22/46 (47%), Positives = 32/46 (69%) Frame = -1 Query: 318 DGEEVLFAMRLCQISAASKRSDSPENDAKVTDLDEIDKIFLRADSI 181 D E F L +I++ S ++DSP + K+++LDEIDKIFLRA S+ Sbjct: 333 DNESDDFEEHLRKIASLSDKADSPAKELKISELDEIDKIFLRASSL 378 Score = 43.9 bits (102), Expect(2) = 2e-09 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -3 Query: 430 TMSESEDLSDLFETDSDGEKMEEKEEKPLYL 338 T SESEDLSD+FETDS+ E+ E+ +E+PLYL Sbjct: 292 TYSESEDLSDMFETDSE-EQAEDSKERPLYL 321