BLASTX nr result
ID: Ophiopogon27_contig00023078
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00023078 (994 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257148.1| mediator of RNA polymerase II transcription ... 69 5e-09 >ref|XP_020257148.1| mediator of RNA polymerase II transcription subunit 13 [Asparagus officinalis] ref|XP_020257149.1| mediator of RNA polymerase II transcription subunit 13 [Asparagus officinalis] gb|ONK75293.1| uncharacterized protein A4U43_C03F15350 [Asparagus officinalis] Length = 1973 Score = 68.9 bits (167), Expect = 5e-09 Identities = 38/53 (71%), Positives = 42/53 (79%), Gaps = 7/53 (13%) Frame = +3 Query: 489 RRVQPTIEFNFDVSEEAIYVHAIISA-------NDDLERVSKQRSSSSTGERL 626 RRVQPTIEF F V+EEAIYVHAIISA +DD+ERVSK RSS+STGE L Sbjct: 166 RRVQPTIEFIFSVNEEAIYVHAIISAKHVRGLCSDDMERVSKHRSSNSTGEGL 218