BLASTX nr result
ID: Ophiopogon27_contig00022949
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00022949 (767 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OVA05418.1| Helicase [Macleaya cordata] 75 1e-11 ref|XP_020534105.1| ATP-dependent RNA helicase SUV3, mitochondri... 75 1e-11 ref|XP_010256133.1| PREDICTED: ATP-dependent RNA helicase SUV3, ... 75 1e-11 ref|XP_020534104.1| ATP-dependent RNA helicase SUV3, mitochondri... 75 1e-11 ref|XP_010256130.1| PREDICTED: ATP-dependent RNA helicase SUV3, ... 75 1e-11 ref|XP_010256129.1| PREDICTED: ATP-dependent RNA helicase SUV3, ... 75 1e-11 ref|XP_010256128.1| PREDICTED: ATP-dependent RNA helicase SUV3, ... 75 1e-11 ref|XP_010256127.1| PREDICTED: ATP-dependent RNA helicase SUV3, ... 75 1e-11 ref|XP_012069677.1| DExH-box ATP-dependent RNA helicase DExH16, ... 75 1e-11 ref|XP_020534103.1| DExH-box ATP-dependent RNA helicase DExH16, ... 75 1e-11 gb|PIN02791.1| Mitochondrial RNA helicase SUV3, DEAD-box superfa... 74 3e-11 ref|XP_020259005.1| ATP-dependent RNA helicase SUV3, mitochondri... 74 4e-11 gb|ONK76542.1| uncharacterized protein A4U43_C03F29350 [Asparagu... 74 4e-11 ref|XP_020259004.1| ATP-dependent RNA helicase SUV3, mitochondri... 74 4e-11 ref|XP_020259003.1| ATP-dependent RNA helicase SUV3, mitochondri... 74 4e-11 ref|XP_020259002.1| ATP-dependent RNA helicase SUV3, mitochondri... 74 4e-11 ref|XP_020259001.1| ATP-dependent RNA helicase SUV3, mitochondri... 74 4e-11 ref|XP_020105346.1| ATP-dependent RNA helicase SUV3, mitochondri... 73 5e-11 ref|XP_021692040.1| DExH-box ATP-dependent RNA helicase DExH16, ... 73 5e-11 gb|OAY75632.1| ATP-dependent RNA helicase SUV3, mitochondrial [A... 73 6e-11 >gb|OVA05418.1| Helicase [Macleaya cordata] Length = 570 Score = 75.1 bits (183), Expect = 1e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 LKV Y RLSPL+PSK PLGSFSNI+TGDCIVTFSRREIY+LK Sbjct: 215 LKVHYYDRLSPLVPSKVPLGSFSNIKTGDCIVTFSRREIYRLK 257 >ref|XP_020534105.1| ATP-dependent RNA helicase SUV3, mitochondrial isoform X4 [Jatropha curcas] Length = 525 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 134 KLKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 ++KVE Y RLSPL+P + PLGSFSNIQTGDCIVTFSRREIYKLK Sbjct: 169 EVKVEYYKRLSPLVPLEIPLGSFSNIQTGDCIVTFSRREIYKLK 212 >ref|XP_010256133.1| PREDICTED: ATP-dependent RNA helicase SUV3, mitochondrial isoform X6 [Nelumbo nucifera] Length = 538 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 +KV+ Y RLSPLIPSK PLGSFS IQTGDCIVTFSRREIY+LK Sbjct: 183 IKVQYYERLSPLIPSKVPLGSFSKIQTGDCIVTFSRREIYRLK 225 >ref|XP_020534104.1| ATP-dependent RNA helicase SUV3, mitochondrial isoform X3 [Jatropha curcas] Length = 556 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 134 KLKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 ++KVE Y RLSPL+P + PLGSFSNIQTGDCIVTFSRREIYKLK Sbjct: 200 EVKVEYYKRLSPLVPLEIPLGSFSNIQTGDCIVTFSRREIYKLK 243 >ref|XP_010256130.1| PREDICTED: ATP-dependent RNA helicase SUV3, mitochondrial isoform X4 [Nelumbo nucifera] Length = 559 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 +KV+ Y RLSPLIPSK PLGSFS IQTGDCIVTFSRREIY+LK Sbjct: 204 IKVQYYERLSPLIPSKVPLGSFSKIQTGDCIVTFSRREIYRLK 246 >ref|XP_010256129.1| PREDICTED: ATP-dependent RNA helicase SUV3, mitochondrial isoform X3 [Nelumbo nucifera] Length = 560 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 +KV+ Y RLSPLIPSK PLGSFS IQTGDCIVTFSRREIY+LK Sbjct: 205 IKVQYYERLSPLIPSKVPLGSFSKIQTGDCIVTFSRREIYRLK 247 >ref|XP_010256128.1| PREDICTED: ATP-dependent RNA helicase SUV3, mitochondrial isoform X2 [Nelumbo nucifera] Length = 566 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 +KV+ Y RLSPLIPSK PLGSFS IQTGDCIVTFSRREIY+LK Sbjct: 211 IKVQYYERLSPLIPSKVPLGSFSKIQTGDCIVTFSRREIYRLK 253 >ref|XP_010256127.1| PREDICTED: ATP-dependent RNA helicase SUV3, mitochondrial isoform X1 [Nelumbo nucifera] Length = 567 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 +KV+ Y RLSPLIPSK PLGSFS IQTGDCIVTFSRREIY+LK Sbjct: 212 IKVQYYERLSPLIPSKVPLGSFSKIQTGDCIVTFSRREIYRLK 254 >ref|XP_012069677.1| DExH-box ATP-dependent RNA helicase DExH16, mitochondrial isoform X2 [Jatropha curcas] gb|KDP40210.1| hypothetical protein JCGZ_02208 [Jatropha curcas] Length = 570 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 134 KLKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 ++KVE Y RLSPL+P + PLGSFSNIQTGDCIVTFSRREIYKLK Sbjct: 214 EVKVEYYKRLSPLVPLEIPLGSFSNIQTGDCIVTFSRREIYKLK 257 >ref|XP_020534103.1| DExH-box ATP-dependent RNA helicase DExH16, mitochondrial isoform X1 [Jatropha curcas] Length = 571 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 134 KLKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 ++KVE Y RLSPL+P + PLGSFSNIQTGDCIVTFSRREIYKLK Sbjct: 215 EVKVEYYKRLSPLVPLEIPLGSFSNIQTGDCIVTFSRREIYKLK 258 >gb|PIN02791.1| Mitochondrial RNA helicase SUV3, DEAD-box superfamily [Handroanthus impetiginosus] Length = 553 Score = 73.9 bits (180), Expect = 3e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 +KV+ Y RLSPL+PSK PLGSFSNIQTGDCIVTFSR EIYK+K Sbjct: 205 VKVQHYERLSPLVPSKVPLGSFSNIQTGDCIVTFSRYEIYKIK 247 >ref|XP_020259005.1| ATP-dependent RNA helicase SUV3, mitochondrial isoform X5 [Asparagus officinalis] Length = 581 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 ++V+ Y RLSPL+PSKTPLGSFSNI+TGDCIVTFSRR IYKLK Sbjct: 211 VQVQYYERLSPLVPSKTPLGSFSNIRTGDCIVTFSRRGIYKLK 253 >gb|ONK76542.1| uncharacterized protein A4U43_C03F29350 [Asparagus officinalis] Length = 586 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 ++V+ Y RLSPL+PSKTPLGSFSNI+TGDCIVTFSRR IYKLK Sbjct: 224 VQVQYYERLSPLVPSKTPLGSFSNIRTGDCIVTFSRRGIYKLK 266 >ref|XP_020259004.1| ATP-dependent RNA helicase SUV3, mitochondrial isoform X4 [Asparagus officinalis] Length = 594 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 ++V+ Y RLSPL+PSKTPLGSFSNI+TGDCIVTFSRR IYKLK Sbjct: 224 VQVQYYERLSPLVPSKTPLGSFSNIRTGDCIVTFSRRGIYKLK 266 >ref|XP_020259003.1| ATP-dependent RNA helicase SUV3, mitochondrial isoform X3 [Asparagus officinalis] Length = 602 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 ++V+ Y RLSPL+PSKTPLGSFSNI+TGDCIVTFSRR IYKLK Sbjct: 240 VQVQYYERLSPLVPSKTPLGSFSNIRTGDCIVTFSRRGIYKLK 282 >ref|XP_020259002.1| ATP-dependent RNA helicase SUV3, mitochondrial isoform X2 [Asparagus officinalis] Length = 609 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 ++V+ Y RLSPL+PSKTPLGSFSNI+TGDCIVTFSRR IYKLK Sbjct: 239 VQVQYYERLSPLVPSKTPLGSFSNIRTGDCIVTFSRRGIYKLK 281 >ref|XP_020259001.1| ATP-dependent RNA helicase SUV3, mitochondrial isoform X1 [Asparagus officinalis] Length = 610 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 ++V+ Y RLSPL+PSKTPLGSFSNI+TGDCIVTFSRR IYKLK Sbjct: 240 VQVQYYERLSPLVPSKTPLGSFSNIRTGDCIVTFSRRGIYKLK 282 >ref|XP_020105346.1| ATP-dependent RNA helicase SUV3, mitochondrial-like isoform X3 [Ananas comosus] Length = 534 Score = 73.2 bits (178), Expect = 5e-11 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = -1 Query: 146 LLMTKLKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 +++ +++V+ Y RLSPL+P K PLGSFSNI+TGDCIVTFSRREIYKLK Sbjct: 169 VIIDEIQVQYYERLSPLVPLKFPLGSFSNIKTGDCIVTFSRREIYKLK 216 >ref|XP_021692040.1| DExH-box ATP-dependent RNA helicase DExH16, mitochondrial isoform X3 [Hevea brasiliensis] Length = 575 Score = 73.2 bits (178), Expect = 5e-11 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 LKVE Y RLSPL+P K PLGSF NIQTGDCIVTFSRREIY++K Sbjct: 220 LKVEYYERLSPLVPLKKPLGSFCNIQTGDCIVTFSRREIYRMK 262 >gb|OAY75632.1| ATP-dependent RNA helicase SUV3, mitochondrial [Ananas comosus] Length = 506 Score = 72.8 bits (177), Expect = 6e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 131 LKVE*Y*RLSPLIPSKTPLGSFSNIQTGDCIVTFSRREIYKLK 3 +KV+ Y RLSPL+P K PLGSFSNI+TGDCIVTFSRREIYKLK Sbjct: 213 VKVQYYERLSPLVPLKFPLGSFSNIKTGDCIVTFSRREIYKLK 255