BLASTX nr result
ID: Ophiopogon27_contig00022931
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00022931 (353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244235.1| phosphatidate cytidylyltransferase 4, chloro... 116 2e-28 >ref|XP_020244235.1| phosphatidate cytidylyltransferase 4, chloroplastic-like [Asparagus officinalis] gb|ONK59016.1| uncharacterized protein A4U43_C08F2100 [Asparagus officinalis] Length = 394 Score = 116 bits (290), Expect = 2e-28 Identities = 65/101 (64%), Positives = 74/101 (73%), Gaps = 5/101 (4%) Frame = +3 Query: 12 SSAALRVDRCGGVLPLSFTPLCPCQSRTLKTLTFSRNPK-----SPRLSVSFRRPRGGLR 176 SSAAL +DRCG V PLS T LCPCQS+TL+ L+FSR + + +L++SFRR RGG Sbjct: 4 SSAALDLDRCG-VFPLSLTSLCPCQSQTLRPLSFSRQARFRSLQNLKLTISFRRSRGGFL 62 Query: 177 RPIAAFVPLSGDVAKFDGGERRDEKAAEESQALAMDQLRKR 299 R I AFVPLSGD K D E RD KAAE SQALAMDQLRKR Sbjct: 63 RSITAFVPLSGDAVKPDDDELRDGKAAEGSQALAMDQLRKR 103