BLASTX nr result
ID: Ophiopogon27_contig00022910
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00022910 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010928275.1| PREDICTED: protein OS-9 homolog [Elaeis guin... 65 1e-09 ref|XP_008788789.1| PREDICTED: protein OS-9 homolog [Phoenix dac... 61 2e-08 >ref|XP_010928275.1| PREDICTED: protein OS-9 homolog [Elaeis guineensis] Length = 298 Score = 65.1 bits (157), Expect = 1e-09 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +3 Query: 6 WHTIHCNEMPGDVEDSSTEDGNRGSQITVVAGDSDRYAT 122 WHTIHCNEMP DV+DSS ED +G+QIT++ D++RYAT Sbjct: 260 WHTIHCNEMPRDVKDSSVEDSLKGTQITIITDDTERYAT 298 >ref|XP_008788789.1| PREDICTED: protein OS-9 homolog [Phoenix dactylifera] Length = 298 Score = 61.2 bits (147), Expect = 2e-08 Identities = 23/39 (58%), Positives = 33/39 (84%) Frame = +3 Query: 6 WHTIHCNEMPGDVEDSSTEDGNRGSQITVVAGDSDRYAT 122 WHTIHCNEMP D++DSS +D +G+QIT++ D++R+AT Sbjct: 260 WHTIHCNEMPRDIKDSSVKDSLKGTQITIITDDTERHAT 298