BLASTX nr result
ID: Ophiopogon27_contig00022613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00022613 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254854.1| ubiquitin-like-specific protease ESD4 isofor... 62 1e-08 ref|XP_020254855.1| ubiquitin-like-specific protease ESD4 isofor... 56 1e-06 gb|ONK78670.1| uncharacterized protein A4U43_C02F21220 [Asparagu... 56 1e-06 ref|XP_018459803.1| PREDICTED: ubiquitin-like-specific protease ... 54 9e-06 ref|XP_018459802.1| PREDICTED: ubiquitin-like-specific protease ... 54 9e-06 ref|XP_006840559.1| ubiquitin-like-specific protease ESD4 [Ambor... 54 9e-06 >ref|XP_020254854.1| ubiquitin-like-specific protease ESD4 isoform X1 [Asparagus officinalis] Length = 266 Score = 61.6 bits (148), Expect = 1e-08 Identities = 35/64 (54%), Positives = 43/64 (67%), Gaps = 7/64 (10%) Frame = -1 Query: 172 AAEKKGI-------SLQRKP*EFQALHQPFAPLTDEDEVEVHRAMKGVKRREVLVTHKAS 14 A+E +GI L R +FQ LH+PF PLT+EDE +V AMKGV+ EVLVTHK S Sbjct: 3 ASEGRGILEARFRNELSRLGMQFQDLHKPFVPLTNEDEDDVLHAMKGVRGYEVLVTHKTS 62 Query: 13 NIEI 2 +IEI Sbjct: 63 SIEI 66 >ref|XP_020254855.1| ubiquitin-like-specific protease ESD4 isoform X2 [Asparagus officinalis] Length = 263 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 118 LHQPFAPLTDEDEVEVHRAMKGVKRREVLVTHKASNIEI 2 LH+PF PLT+EDE +V AMKGV+ EVLVTHK S+IEI Sbjct: 25 LHKPFVPLTNEDEDDVLHAMKGVRGYEVLVTHKTSSIEI 63 >gb|ONK78670.1| uncharacterized protein A4U43_C02F21220 [Asparagus officinalis] Length = 398 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 118 LHQPFAPLTDEDEVEVHRAMKGVKRREVLVTHKASNIEI 2 LH+PF PLT+EDE +V AMKGV+ EVLVTHK S+IEI Sbjct: 160 LHKPFVPLTNEDEDDVLHAMKGVRGYEVLVTHKTSSIEI 198 >ref|XP_018459803.1| PREDICTED: ubiquitin-like-specific protease ESD4 isoform X2 [Raphanus sativus] Length = 461 Score = 53.9 bits (128), Expect = 9e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -1 Query: 115 HQPFAPLTDEDEVEVHRAMKGVKRREVLVTHKASNIEI 2 H+PF PLT+E+E EV+RA G RR+VLV+H++SNI+I Sbjct: 225 HEPFIPLTEEEEAEVNRAFSGRNRRKVLVSHESSNIDI 262 >ref|XP_018459802.1| PREDICTED: ubiquitin-like-specific protease ESD4 isoform X1 [Raphanus sativus] Length = 462 Score = 53.9 bits (128), Expect = 9e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -1 Query: 115 HQPFAPLTDEDEVEVHRAMKGVKRREVLVTHKASNIEI 2 H+PF PLT+E+E EV+RA G RR+VLV+H++SNI+I Sbjct: 226 HEPFIPLTEEEEAEVNRAFSGRNRRKVLVSHESSNIDI 263 >ref|XP_006840559.1| ubiquitin-like-specific protease ESD4 [Amborella trichopoda] ref|XP_020520465.1| ubiquitin-like-specific protease ESD4 [Amborella trichopoda] ref|XP_020520466.1| ubiquitin-like-specific protease ESD4 [Amborella trichopoda] ref|XP_020520467.1| ubiquitin-like-specific protease ESD4 [Amborella trichopoda] ref|XP_020520469.1| ubiquitin-like-specific protease ESD4 [Amborella trichopoda] gb|ERN02234.1| hypothetical protein AMTR_s00045p00222990 [Amborella trichopoda] Length = 564 Score = 53.9 bits (128), Expect = 9e-06 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -1 Query: 154 ISLQRKP*EFQALHQPFAPLTDEDEVEVHRAMKGVKRREVLVTHKASNIEI 2 IS +K +LH+P PL++EDE V RA++G R EVLV HK+SNIEI Sbjct: 313 ISQSQKEKVEDSLHKPLEPLSNEDEANVSRALQGGSRHEVLVVHKSSNIEI 363