BLASTX nr result
ID: Ophiopogon27_contig00022604
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00022604 (559 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256145.1| peptidyl-prolyl cis-trans isomerase CYP63-li... 59 8e-07 ref|XP_020256144.1| peptidyl-prolyl cis-trans isomerase CYP63-li... 59 8e-07 ref|XP_020256142.1| peptidyl-prolyl cis-trans isomerase CYP63-li... 59 8e-07 >ref|XP_020256145.1| peptidyl-prolyl cis-trans isomerase CYP63-like isoform X3 [Asparagus officinalis] Length = 686 Score = 58.9 bits (141), Expect = 8e-07 Identities = 33/53 (62%), Positives = 35/53 (66%) Frame = -1 Query: 559 RSHSRSISRSPVKYXXXXXXXXXXXXXXXSPIADRRPAVSDRLRSRLGPQGNS 401 RS SRS SRSPVKY SPIADRRPAVSD LRSRLGP+G+S Sbjct: 574 RSRSRSNSRSPVKYRSRGRDRSLSPRRSRSPIADRRPAVSDMLRSRLGPRGDS 626 >ref|XP_020256144.1| peptidyl-prolyl cis-trans isomerase CYP63-like isoform X2 [Asparagus officinalis] Length = 688 Score = 58.9 bits (141), Expect = 8e-07 Identities = 33/53 (62%), Positives = 35/53 (66%) Frame = -1 Query: 559 RSHSRSISRSPVKYXXXXXXXXXXXXXXXSPIADRRPAVSDRLRSRLGPQGNS 401 RS SRS SRSPVKY SPIADRRPAVSD LRSRLGP+G+S Sbjct: 576 RSRSRSNSRSPVKYRSRGRDRSLSPRRSRSPIADRRPAVSDMLRSRLGPRGDS 628 >ref|XP_020256142.1| peptidyl-prolyl cis-trans isomerase CYP63-like isoform X1 [Asparagus officinalis] ref|XP_020256143.1| peptidyl-prolyl cis-trans isomerase CYP63-like isoform X1 [Asparagus officinalis] gb|ONK74380.1| uncharacterized protein A4U43_C03F5630 [Asparagus officinalis] Length = 689 Score = 58.9 bits (141), Expect = 8e-07 Identities = 33/53 (62%), Positives = 35/53 (66%) Frame = -1 Query: 559 RSHSRSISRSPVKYXXXXXXXXXXXXXXXSPIADRRPAVSDRLRSRLGPQGNS 401 RS SRS SRSPVKY SPIADRRPAVSD LRSRLGP+G+S Sbjct: 577 RSRSRSNSRSPVKYRSRGRDRSLSPRRSRSPIADRRPAVSDMLRSRLGPRGDS 629