BLASTX nr result
ID: Ophiopogon27_contig00022485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00022485 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241010.1| LOW QUALITY PROTEIN: uncharacterized protein... 59 1e-10 gb|ONK60257.1| uncharacterized protein A4U43_C08F16140 [Asparagu... 59 1e-10 ref|XP_008801892.1| PREDICTED: uncharacterized GTP-binding prote... 62 2e-10 ref|XP_010063529.1| PREDICTED: uncharacterized protein LOC104450... 58 8e-10 ref|XP_020090331.1| uncharacterized protein LOC109711602 [Ananas... 60 8e-10 ref|XP_010906004.1| PREDICTED: uncharacterized protein LOC105033... 60 1e-09 ref|XP_010906005.1| PREDICTED: uncharacterized protein LOC105033... 60 1e-09 ref|XP_021731775.1| uncharacterized protein LOC110698617 [Chenop... 59 1e-09 ref|XP_021736657.1| uncharacterized protein LOC110703209 [Chenop... 59 1e-09 ref|XP_022955899.1| uncharacterized protein LOC111457746 [Cucurb... 59 1e-09 ref|XP_012073113.1| uncharacterized protein LOC105634803 [Jatrop... 59 1e-09 ref|XP_023527894.1| COBW domain-containing protein 1 [Cucurbita ... 59 1e-09 ref|XP_022980166.1| uncharacterized protein LOC111479636 [Cucurb... 59 1e-09 ref|XP_011007690.1| PREDICTED: COBW domain-containing protein 1-... 59 2e-09 ref|XP_018859334.1| PREDICTED: uncharacterized protein LOC109021... 59 2e-09 gb|KZV22601.1| prli-interacting factor l [Dorcoceras hygrometricum] 59 2e-09 ref|XP_007142702.1| hypothetical protein PHAVU_007G009700g [Phas... 57 2e-09 ref|XP_011044875.1| PREDICTED: COBW domain-containing protein 1 ... 57 2e-09 ref|XP_011044876.1| PREDICTED: COBW domain-containing protein 1 ... 57 2e-09 gb|KZV22603.1| COBW domain-containing protein 1 [Dorcoceras hygr... 59 2e-09 >ref|XP_020241010.1| LOW QUALITY PROTEIN: uncharacterized protein LOC109819635 [Asparagus officinalis] Length = 471 Score = 59.3 bits (142), Expect(2) = 1e-10 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGPEEPRINK+VFIGK Sbjct: 424 QGVHDIFQGSPDRLWGPEEPRINKVVFIGK 453 Score = 34.3 bits (77), Expect(2) = 1e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLLQQ 212 ++ KNLDAQ+LEKGF +CLL Q Sbjct: 449 VFIGKNLDAQELEKGFKTCLLPQ 471 >gb|ONK60257.1| uncharacterized protein A4U43_C08F16140 [Asparagus officinalis] Length = 180 Score = 59.3 bits (142), Expect(2) = 1e-10 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGPEEPRINK+VFIGK Sbjct: 133 QGVHDIFQGSPDRLWGPEEPRINKVVFIGK 162 Score = 34.3 bits (77), Expect(2) = 1e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLLQQ 212 ++ KNLDAQ+LEKGF +CLL Q Sbjct: 158 VFIGKNLDAQELEKGFKTCLLPQ 180 >ref|XP_008801892.1| PREDICTED: uncharacterized GTP-binding protein YjiA-like [Phoenix dactylifera] Length = 460 Score = 62.0 bits (149), Expect(2) = 2e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DRSWGPEEPRINKIVFIGK Sbjct: 415 QGVHDIFQGSPDRSWGPEEPRINKIVFIGK 444 Score = 30.8 bits (68), Expect(2) = 2e-10 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNL+AQ+LEKGF +CLL Sbjct: 440 VFIGKNLNAQELEKGFKACLL 460 >ref|XP_010063529.1| PREDICTED: uncharacterized protein LOC104450601 [Eucalyptus grandis] gb|KCW70753.1| hypothetical protein EUGRSUZ_F03922 [Eucalyptus grandis] Length = 452 Score = 58.2 bits (139), Expect(2) = 8e-10 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGP+EPR+NKIVFIGK Sbjct: 407 QGVHDIFQGSPDRLWGPDEPRVNKIVFIGK 436 Score = 32.7 bits (73), Expect(2) = 8e-10 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDAQ+LEKGF +CLL Sbjct: 432 VFIGKNLDAQELEKGFKACLL 452 >ref|XP_020090331.1| uncharacterized protein LOC109711602 [Ananas comosus] Length = 447 Score = 59.7 bits (143), Expect(2) = 8e-10 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGPEEPRINKIVFIGK Sbjct: 402 QGVHDIFQGSPDRLWGPEEPRINKIVFIGK 431 Score = 31.2 bits (69), Expect(2) = 8e-10 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDA++LEKGF +CLL Sbjct: 427 VFIGKNLDAKELEKGFKACLL 447 >ref|XP_010906004.1| PREDICTED: uncharacterized protein LOC105033055 isoform X1 [Elaeis guineensis] Length = 460 Score = 59.7 bits (143), Expect(2) = 1e-09 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGPEEPRINKIVFIGK Sbjct: 415 QGVHDIFQGSPDRFWGPEEPRINKIVFIGK 444 Score = 30.8 bits (68), Expect(2) = 1e-09 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNL+AQ+LEKGF +CLL Sbjct: 440 VFIGKNLNAQELEKGFKACLL 460 >ref|XP_010906005.1| PREDICTED: uncharacterized protein LOC105033055 isoform X2 [Elaeis guineensis] Length = 447 Score = 59.7 bits (143), Expect(2) = 1e-09 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGPEEPRINKIVFIGK Sbjct: 402 QGVHDIFQGSPDRFWGPEEPRINKIVFIGK 431 Score = 30.8 bits (68), Expect(2) = 1e-09 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNL+AQ+LEKGF +CLL Sbjct: 427 VFIGKNLNAQELEKGFKACLL 447 >ref|XP_021731775.1| uncharacterized protein LOC110698617 [Chenopodium quinoa] Length = 469 Score = 58.9 bits (141), Expect(2) = 1e-09 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGP+EPRINKIVFIGK Sbjct: 424 QGVHDIFQGSPDRPWGPDEPRINKIVFIGK 453 Score = 31.2 bits (69), Expect(2) = 1e-09 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLD Q+LEKGF +CLL Sbjct: 449 VFIGKNLDGQELEKGFKTCLL 469 >ref|XP_021736657.1| uncharacterized protein LOC110703209 [Chenopodium quinoa] Length = 464 Score = 58.9 bits (141), Expect(2) = 1e-09 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGP+EPRINKIVFIGK Sbjct: 419 QGVHDIFQGSPDRPWGPDEPRINKIVFIGK 448 Score = 31.2 bits (69), Expect(2) = 1e-09 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLD Q+LEKGF +CLL Sbjct: 444 VFIGKNLDGQELEKGFKTCLL 464 >ref|XP_022955899.1| uncharacterized protein LOC111457746 [Cucurbita moschata] Length = 459 Score = 58.5 bits (140), Expect(2) = 1e-09 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGP+EPRINKIVFIGK Sbjct: 414 QGVHDIFQGSPDRLWGPDEPRINKIVFIGK 443 Score = 31.6 bits (70), Expect(2) = 1e-09 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDA++LEKGF +CLL Sbjct: 439 VFIGKNLDAEELEKGFKACLL 459 >ref|XP_012073113.1| uncharacterized protein LOC105634803 [Jatropha curcas] gb|KDP37034.1| hypothetical protein JCGZ_06090 [Jatropha curcas] Length = 457 Score = 58.5 bits (140), Expect(2) = 1e-09 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGP+EPRINKIVFIGK Sbjct: 412 QGVHDIFQGSPDRLWGPDEPRINKIVFIGK 441 Score = 31.6 bits (70), Expect(2) = 1e-09 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDAQ++EKGF CLL Sbjct: 437 VFIGKNLDAQEIEKGFKDCLL 457 >ref|XP_023527894.1| COBW domain-containing protein 1 [Cucurbita pepo subsp. pepo] Length = 455 Score = 58.5 bits (140), Expect(2) = 1e-09 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGP+EPRINKIVFIGK Sbjct: 410 QGVHDIFQGSPDRLWGPDEPRINKIVFIGK 439 Score = 31.6 bits (70), Expect(2) = 1e-09 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDA++LEKGF +CLL Sbjct: 435 VFIGKNLDAEELEKGFKACLL 455 >ref|XP_022980166.1| uncharacterized protein LOC111479636 [Cucurbita maxima] Length = 453 Score = 58.5 bits (140), Expect(2) = 1e-09 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGP+EPRINKIVFIGK Sbjct: 408 QGVHDIFQGSPDRLWGPDEPRINKIVFIGK 437 Score = 31.6 bits (70), Expect(2) = 1e-09 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDA++LEKGF +CLL Sbjct: 433 VFIGKNLDAEELEKGFKACLL 453 >ref|XP_011007690.1| PREDICTED: COBW domain-containing protein 1-like isoform X1 [Populus euphratica] Length = 453 Score = 58.5 bits (140), Expect(2) = 2e-09 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGPEEPR+NKIVFIGK Sbjct: 408 QGVHDIFEGSPDRLWGPEEPRMNKIVFIGK 437 Score = 31.2 bits (69), Expect(2) = 2e-09 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDAQ+L+KGF +CLL Sbjct: 433 VFIGKNLDAQELKKGFKACLL 453 >ref|XP_018859334.1| PREDICTED: uncharacterized protein LOC109021197, partial [Juglans regia] Length = 187 Score = 59.3 bits (142), Expect(2) = 2e-09 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGKK 159 +GVHDIF GS DR WGP+EPR+NKIVFIGKK Sbjct: 142 QGVHDIFQGSPDRLWGPDEPRMNKIVFIGKK 172 Score = 30.4 bits (67), Expect(2) = 2e-09 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ K LDAQ+LEKGF +CLL Sbjct: 167 VFIGKKLDAQELEKGFKACLL 187 >gb|KZV22601.1| prli-interacting factor l [Dorcoceras hygrometricum] Length = 643 Score = 58.5 bits (140), Expect(2) = 2e-09 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGP+EPRINKIVFIGK Sbjct: 476 QGVHDIFQGSPDRLWGPDEPRINKIVFIGK 505 Score = 30.8 bits (68), Expect(2) = 2e-09 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDA++LEKGF CLL Sbjct: 501 VFIGKNLDAKELEKGFKDCLL 521 >ref|XP_007142702.1| hypothetical protein PHAVU_007G009700g [Phaseolus vulgaris] gb|ESW14696.1| hypothetical protein PHAVU_007G009700g [Phaseolus vulgaris] Length = 448 Score = 57.0 bits (136), Expect(2) = 2e-09 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS +R WGP+EPRINKIVFIGK Sbjct: 403 QGVHDIFQGSPERLWGPDEPRINKIVFIGK 432 Score = 32.3 bits (72), Expect(2) = 2e-09 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDA DLEKGF +CLL Sbjct: 428 VFIGKNLDAMDLEKGFKACLL 448 >ref|XP_011044875.1| PREDICTED: COBW domain-containing protein 1 isoform X1 [Populus euphratica] Length = 440 Score = 56.6 bits (135), Expect(2) = 2e-09 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGP EPR+NKIVFIGK Sbjct: 395 QGVHDIFQGSPDRLWGPNEPRMNKIVFIGK 424 Score = 32.7 bits (73), Expect(2) = 2e-09 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDAQ+LEKGF +CLL Sbjct: 420 VFIGKNLDAQELEKGFKACLL 440 >ref|XP_011044876.1| PREDICTED: COBW domain-containing protein 1 isoform X2 [Populus euphratica] Length = 436 Score = 56.6 bits (135), Expect(2) = 2e-09 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGP EPR+NKIVFIGK Sbjct: 391 QGVHDIFQGSPDRLWGPNEPRMNKIVFIGK 420 Score = 32.7 bits (73), Expect(2) = 2e-09 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDAQ+LEKGF +CLL Sbjct: 416 VFIGKNLDAQELEKGFKACLL 436 >gb|KZV22603.1| COBW domain-containing protein 1 [Dorcoceras hygrometricum] Length = 192 Score = 58.5 bits (140), Expect(2) = 2e-09 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 67 KGVHDIFHGSSDRSWGPEEPRINKIVFIGK 156 +GVHDIF GS DR WGP+EPRINKIVFIGK Sbjct: 138 QGVHDIFQGSPDRLWGPDEPRINKIVFIGK 167 Score = 30.8 bits (68), Expect(2) = 2e-09 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 144 IYRKKNLDAQDLEKGF*SCLL 206 ++ KNLDA++LEKGF CLL Sbjct: 163 VFIGKNLDAKELEKGFKDCLL 183