BLASTX nr result
ID: Ophiopogon27_contig00022440
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00022440 (679 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO54021.1| hypothetical protein CISIN_1g0066591mg, partial [... 65 3e-09 ref|XP_020274732.1| glutamine--fructose-6-phosphate aminotransfe... 67 5e-09 ref|XP_016729380.1| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 ref|XP_012460166.1| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 gb|KJB75139.1| hypothetical protein B456_012G026300 [Gossypium r... 66 8e-09 ref|XP_020180088.1| glutamine--fructose-6-phosphate aminotransfe... 66 8e-09 ref|XP_003633566.1| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 ref|XP_022876645.1| glutamine--fructose-6-phosphate aminotransfe... 66 8e-09 ref|XP_018834060.1| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 ref|XP_023900583.1| glutamine--fructose-6-phosphate aminotransfe... 66 8e-09 ref|XP_010244880.1| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 ref|XP_019051727.1| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 ref|XP_022742033.1| glutamine--fructose-6-phosphate aminotransfe... 66 8e-09 ref|XP_007029243.2| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 gb|EOY09745.1| Glutamine-fructose-6-phosphate transaminase (isom... 66 8e-09 ref|XP_017612274.1| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 ref|XP_016751060.1| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 ref|XP_016729379.1| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 ref|XP_015875807.1| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 ref|XP_012460165.1| PREDICTED: glutamine--fructose-6-phosphate a... 66 8e-09 >gb|KDO54021.1| hypothetical protein CISIN_1g0066591mg, partial [Citrus sinensis] Length = 225 Score = 65.5 bits (158), Expect = 3e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 139 EVLKETLIRHGFTFESETDTEVIPKLAKFVFDKANE 174 >ref|XP_020274732.1| glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Asparagus officinalis] gb|ONK62803.1| uncharacterized protein A4U43_C07F8300 [Asparagus officinalis] Length = 689 Score = 66.6 bits (161), Expect = 5e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+TRHGFTFESET TEVIPKLAKFV+DKA E Sbjct: 152 EVLKETLTRHGFTFESETDTEVIPKLAKFVYDKARE 187 >ref|XP_016729380.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like isoform X2 [Gossypium hirsutum] Length = 620 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 143 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 178 >ref|XP_012460166.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like isoform X2 [Gossypium raimondii] gb|KJB75135.1| hypothetical protein B456_012G026300 [Gossypium raimondii] gb|KJB75137.1| hypothetical protein B456_012G026300 [Gossypium raimondii] Length = 620 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 143 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 178 >gb|KJB75139.1| hypothetical protein B456_012G026300 [Gossypium raimondii] Length = 632 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 143 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 178 >ref|XP_020180088.1| glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Aegilops tauschii subsp. tauschii] Length = 676 Score = 65.9 bits (159), Expect = 8e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKA 671 EVLKET+TRHGFTFES+T TEVIPKLAKFVFDKA Sbjct: 140 EVLKETLTRHGFTFESDTDTEVIPKLAKFVFDKA 173 >ref|XP_003633566.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Vitis vinifera] Length = 684 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 133 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 168 >ref|XP_022876645.1| glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Olea europaea var. sylvestris] Length = 687 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 136 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 171 >ref|XP_018834060.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Juglans regia] Length = 691 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 140 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 175 >ref|XP_023900583.1| glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Quercus suber] gb|POE50621.1| glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Quercus suber] Length = 692 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 141 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 176 >ref|XP_010244880.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 isoform X2 [Nelumbo nucifera] Length = 692 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 140 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 175 >ref|XP_019051727.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 isoform X1 [Nelumbo nucifera] Length = 693 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 140 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 175 >ref|XP_022742033.1| glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like isoform X2 [Durio zibethinus] Length = 694 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 143 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 178 >ref|XP_007029243.2| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Theobroma cacao] Length = 694 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 143 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 178 >gb|EOY09745.1| Glutamine-fructose-6-phosphate transaminase (isomerizing)s,sugar binding,transaminases isoform 1 [Theobroma cacao] Length = 694 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 143 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 178 >ref|XP_017612274.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Gossypium arboreum] Length = 695 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 143 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 178 >ref|XP_016751060.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Gossypium hirsutum] ref|XP_016751061.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Gossypium hirsutum] ref|XP_016751063.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Gossypium hirsutum] ref|XP_016751064.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like [Gossypium hirsutum] Length = 695 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 143 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 178 >ref|XP_016729379.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like isoform X1 [Gossypium hirsutum] gb|PPD70625.1| hypothetical protein GOBAR_DD32499 [Gossypium barbadense] Length = 695 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 143 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 178 >ref|XP_015875807.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 [Ziziphus jujuba] Length = 695 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 144 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 179 >ref|XP_012460165.1| PREDICTED: glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like isoform X1 [Gossypium raimondii] gb|KJB75136.1| hypothetical protein B456_012G026300 [Gossypium raimondii] gb|KJB75138.1| hypothetical protein B456_012G026300 [Gossypium raimondii] gb|KJB75140.1| hypothetical protein B456_012G026300 [Gossypium raimondii] Length = 695 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 570 EVLKETITRHGFTFESETATEVIPKLAKFVFDKACE 677 EVLKET+ RHGFTFESET TEVIPKLAKFVFDKA E Sbjct: 143 EVLKETLVRHGFTFESETDTEVIPKLAKFVFDKANE 178