BLASTX nr result
ID: Ophiopogon27_contig00022051
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00022051 (738 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC00716.1| hypothetical protein RhiirA5_458344 [Rhizophagus ... 57 9e-06 gb|EXX57826.1| hypothetical protein RirG_203500 [Rhizophagus irr... 57 9e-06 >gb|PKC00716.1| hypothetical protein RhiirA5_458344 [Rhizophagus irregularis] gb|PKC63735.1| hypothetical protein RhiirA1_366930 [Rhizophagus irregularis] gb|PKY21479.1| hypothetical protein RhiirB3_470349 [Rhizophagus irregularis] Length = 740 Score = 57.4 bits (137), Expect = 9e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -1 Query: 375 EHQPSYIXXXXXXXXSHVYNHDHSLPNSRHRSFDVL 268 EHQPSY+ SHV+NHDHSLPN+RHRSFDVL Sbjct: 411 EHQPSYVTSSTNNSSSHVFNHDHSLPNARHRSFDVL 446 >gb|EXX57826.1| hypothetical protein RirG_203500 [Rhizophagus irregularis DAOM 197198w] dbj|GBC25121.1| nuclear division rft1 protein [Rhizophagus irregularis DAOM 181602] gb|POG75977.1| velvet factor-domain-containing protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 740 Score = 57.4 bits (137), Expect = 9e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -1 Query: 375 EHQPSYIXXXXXXXXSHVYNHDHSLPNSRHRSFDVL 268 EHQPSY+ SHV+NHDHSLPN+RHRSFDVL Sbjct: 411 EHQPSYVTSSTNNSSSHVFNHDHSLPNARHRSFDVL 446