BLASTX nr result
ID: Ophiopogon27_contig00022024
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00022024 (375 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA57505.1| hypothetical protein AXF42_Ash020749 [Apostasia s... 54 5e-06 >gb|PKA57505.1| hypothetical protein AXF42_Ash020749 [Apostasia shenzhenica] Length = 187 Score = 53.5 bits (127), Expect = 5e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 370 KILNKLNCNTYVLDLPKNYGISCVFNINDLVEYK 269 KIL KL NTYV+DLP N+GIS +FNI+DLV YK Sbjct: 101 KILKKLESNTYVVDLPSNFGISTIFNISDLVVYK 134