BLASTX nr result
ID: Ophiopogon27_contig00021866
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00021866 (595 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251734.1| uncharacterized protein LOC109829069 [Aspara... 60 5e-07 >ref|XP_020251734.1| uncharacterized protein LOC109829069 [Asparagus officinalis] gb|ONK78932.1| uncharacterized protein A4U43_C01F1130 [Asparagus officinalis] Length = 364 Score = 59.7 bits (143), Expect = 5e-07 Identities = 41/98 (41%), Positives = 53/98 (54%), Gaps = 6/98 (6%) Frame = -1 Query: 595 KRWVRLESLGD-RVLFIHQNFVCSLLADDAGVEGNCIYCLVPSKIQEICGQNSSGVGPIP 419 K WV++ES+GD RV+ IH SLLA D G GNCIY G+NS G P Sbjct: 281 KMWVKVESVGDNRVIVIHWVQSVSLLAADIGARGNCIYFAT--------GENS---GQGP 329 Query: 418 WSIFNLGSGMLTESPLFYAPTPHTHR-----MFVPSLC 320 W +F+LG+ +T+ L P+ R +FVPSLC Sbjct: 330 WKVFDLGTRKMTDLQL---PSATQFRNLAQLLFVPSLC 364