BLASTX nr result
ID: Ophiopogon27_contig00021833
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00021833 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254316.1| CASP-like protein 1D1 [Asparagus officinalis] 70 1e-12 ref|XP_004956013.1| CASP-like protein 1D1 [Setaria italica] >gi|... 63 2e-09 ref|XP_009419511.1| PREDICTED: CASP-like protein 1D1 [Musa acumi... 62 5e-09 dbj|BAF46307.1| integral membrane family protein [Ipomoea nil] 60 8e-09 ref|XP_011090848.1| CASP-like protein 1 [Sesamum indicum] 61 1e-08 gb|PIN16036.1| hypothetical protein CDL12_11305 [Handroanthus im... 61 1e-08 gb|PAN10593.1| hypothetical protein PAHAL_B01520 [Panicum hallii... 61 1e-08 gb|OEL37634.1| CASP-like protein 1D1 [Dichanthelium oligosanthes] 61 1e-08 sp|A2PZE5.2|CSPL1_IPONI RecName: Full=CASP-like protein IN26; Al... 60 2e-08 ref|XP_008652280.1| CASP-like protein 1D1 [Zea mays] >gi|1142854... 60 2e-08 ref|XP_019172884.1| PREDICTED: CASP-like protein IN26 [Ipomoea nil] 60 2e-08 ref|NP_001151672.1| CASP-like protein 1D1 [Zea mays] >gi|2267136... 60 2e-08 ref|XP_008799290.1| PREDICTED: CASP-like protein 1D1 [Phoenix da... 60 2e-08 ref|XP_021867307.1| CASP-like protein Ni6 [Spinacia oleracea] >g... 60 3e-08 emb|CBI26108.3| unnamed protein product, partial [Vitis vinifera] 59 4e-08 ref|XP_014507677.1| CASP-like protein 1D1 [Vigna radiata var. ra... 59 4e-08 ref|XP_017442509.1| PREDICTED: CASP-like protein 1D1 [Vigna angu... 59 4e-08 ref|XP_021728870.1| CASP-like protein Ni6 [Chenopodium quinoa] 59 4e-08 gb|OMO98412.1| hypothetical protein COLO4_13923 [Corchorus olito... 59 5e-08 gb|OMO53716.1| hypothetical protein CCACVL1_28408 [Corchorus cap... 59 5e-08 >ref|XP_020254316.1| CASP-like protein 1D1 [Asparagus officinalis] Length = 135 Score = 70.1 bits (170), Expect = 1e-12 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVAYIGLKGN HVNW KICDKFGKYCRH+G Sbjct: 76 GGVAYIGLKGNDHVNWMKICDKFGKYCRHVG 106 >ref|XP_004956013.1| CASP-like protein 1D1 [Setaria italica] gb|KQL23306.1| hypothetical protein SETIT_032948mg [Setaria italica] Length = 196 Score = 63.2 bits (152), Expect = 2e-09 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVA+IGLKGNSH WAKICD +GK+CRHIG Sbjct: 137 GGVAWIGLKGNSHTRWAKICDTYGKFCRHIG 167 >ref|XP_009419511.1| PREDICTED: CASP-like protein 1D1 [Musa acuminata subsp. malaccensis] Length = 207 Score = 62.0 bits (149), Expect = 5e-09 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 G VAYIGLKGNSHVNW KIC+ +GK+CRH+G Sbjct: 148 GSVAYIGLKGNSHVNWNKICNMYGKFCRHVG 178 >dbj|BAF46307.1| integral membrane family protein [Ipomoea nil] Length = 152 Score = 60.5 bits (145), Expect = 8e-09 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVAYIGLKGNSHV W K+C+K+GK C H+G Sbjct: 92 GGVAYIGLKGNSHVGWTKVCNKYGKLCTHLG 122 >ref|XP_011090848.1| CASP-like protein 1 [Sesamum indicum] Length = 210 Score = 61.2 bits (147), Expect = 1e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVAYIGLKGN+HV W KICD +G++CRHIG Sbjct: 147 GGVAYIGLKGNTHVQWRKICDIYGEFCRHIG 177 >gb|PIN16036.1| hypothetical protein CDL12_11305 [Handroanthus impetiginosus] Length = 212 Score = 61.2 bits (147), Expect = 1e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVAYIGLKGNSHV WAKICD F +C+HIG Sbjct: 152 GGVAYIGLKGNSHVQWAKICDLFDDFCKHIG 182 >gb|PAN10593.1| hypothetical protein PAHAL_B01520 [Panicum hallii] gb|PAN10594.1| hypothetical protein PAHAL_B01520 [Panicum hallii] gb|PAN10595.1| hypothetical protein PAHAL_B01520 [Panicum hallii] Length = 189 Score = 60.8 bits (146), Expect = 1e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVA+IGLKGNSH W KICD +GK+CRHIG Sbjct: 130 GGVAWIGLKGNSHTRWNKICDTYGKFCRHIG 160 >gb|OEL37634.1| CASP-like protein 1D1 [Dichanthelium oligosanthes] Length = 198 Score = 60.8 bits (146), Expect = 1e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVA+IGLKGN+H W+KICD +GK+CRHIG Sbjct: 139 GGVAWIGLKGNTHTRWSKICDTYGKFCRHIG 169 >sp|A2PZE5.2|CSPL1_IPONI RecName: Full=CASP-like protein IN26; AltName: Full=CASP-like protein 1D1; Short=InCASPL1D1, partial [Ipomoea nil] Length = 195 Score = 60.5 bits (145), Expect = 2e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVAYIGLKGNSHV W K+C+K+GK C H+G Sbjct: 135 GGVAYIGLKGNSHVGWTKVCNKYGKLCTHLG 165 >ref|XP_008652280.1| CASP-like protein 1D1 [Zea mays] gb|ONM52947.1| CASP-like protein 1D1 [Zea mays] Length = 196 Score = 60.5 bits (145), Expect = 2e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVA+IGLKGNSH NW KIC+ +GK+CRHIG Sbjct: 137 GGVAWIGLKGNSHTNWNKICNIYGKFCRHIG 167 >ref|XP_019172884.1| PREDICTED: CASP-like protein IN26 [Ipomoea nil] Length = 202 Score = 60.5 bits (145), Expect = 2e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVAYIGLKGNSHV W K+C+K+GK C H+G Sbjct: 142 GGVAYIGLKGNSHVGWTKVCNKYGKLCTHLG 172 >ref|NP_001151672.1| CASP-like protein 1D1 [Zea mays] sp|B6U361.1|CSPL3_MAIZE RecName: Full=CASP-like protein 1D1; Short=ZmCASPL1D1 gb|ACG43794.1| plant integral membrane protein TIGR01569 containing protein [Zea mays] Length = 202 Score = 60.5 bits (145), Expect = 2e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVA+IGLKGNSH NW KIC+ +GK+CRHIG Sbjct: 143 GGVAWIGLKGNSHTNWNKICNIYGKFCRHIG 173 >ref|XP_008799290.1| PREDICTED: CASP-like protein 1D1 [Phoenix dactylifera] Length = 204 Score = 60.5 bits (145), Expect = 2e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 G VAYIGLKGNSHV W KIC+ +GK+CRHIG Sbjct: 145 GSVAYIGLKGNSHVGWTKICNVYGKFCRHIG 175 >ref|XP_021867307.1| CASP-like protein Ni6 [Spinacia oleracea] gb|KNA24831.1| hypothetical protein SOVF_012170 [Spinacia oleracea] Length = 193 Score = 59.7 bits (143), Expect = 3e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGV YIGLKGN+HV W KIC+ +GK+CRHIG Sbjct: 132 GGVGYIGLKGNTHVRWMKICNLYGKFCRHIG 162 >emb|CBI26108.3| unnamed protein product, partial [Vitis vinifera] Length = 148 Score = 58.5 bits (140), Expect = 4e-08 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVAY+GLKGNSHV W K+C+ + K+CRH+G Sbjct: 88 GGVAYVGLKGNSHVGWNKVCNTYDKFCRHVG 118 >ref|XP_014507677.1| CASP-like protein 1D1 [Vigna radiata var. radiata] Length = 189 Score = 59.3 bits (142), Expect = 4e-08 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVAY+GLKGN HVNW KIC+ + K+CRH+G Sbjct: 129 GGVAYVGLKGNKHVNWNKICNVYDKFCRHVG 159 >ref|XP_017442509.1| PREDICTED: CASP-like protein 1D1 [Vigna angularis] gb|KOM33549.1| hypothetical protein LR48_Vigan01g310500 [Vigna angularis] dbj|BAT77174.1| hypothetical protein VIGAN_01526800 [Vigna angularis var. angularis] Length = 189 Score = 59.3 bits (142), Expect = 4e-08 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVAY+GLKGN HVNW KIC+ + K+CRH+G Sbjct: 129 GGVAYVGLKGNKHVNWDKICNVYDKFCRHVG 159 >ref|XP_021728870.1| CASP-like protein Ni6 [Chenopodium quinoa] Length = 193 Score = 59.3 bits (142), Expect = 4e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGV YIGLKGN+HV W KIC+ +GK+CRHIG Sbjct: 133 GGVGYIGLKGNTHVKWMKICNFYGKFCRHIG 163 >gb|OMO98412.1| hypothetical protein COLO4_13923 [Corchorus olitorius] Length = 204 Score = 59.3 bits (142), Expect = 5e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVAYIGLKGN HV W KIC+ +GK+CRH+G Sbjct: 144 GGVAYIGLKGNDHVAWNKICNLYGKFCRHVG 174 >gb|OMO53716.1| hypothetical protein CCACVL1_28408 [Corchorus capsularis] Length = 204 Score = 59.3 bits (142), Expect = 5e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 391 GGVAYIGLKGNSHVNWAKICDKFGKYCRHIG 299 GGVAYIGLKGN HV W KIC+ +GK+CRH+G Sbjct: 144 GGVAYIGLKGNDHVAWNKICNLYGKFCRHVG 174