BLASTX nr result
ID: Ophiopogon27_contig00021813
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00021813 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020249204.1| single-stranded DNA-bindig protein WHY2, mit... 59 2e-07 gb|ONK56487.1| uncharacterized protein A4U43_C10F9260 [Asparagus... 59 2e-07 >ref|XP_020249204.1| single-stranded DNA-bindig protein WHY2, mitochondrial-like [Asparagus officinalis] Length = 327 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 281 AILNSAQKTTERFSVPVTKAEFAVMRTAFG 192 ++LNSAQKTTERFSVPVTKAEFAVMRTAFG Sbjct: 257 SVLNSAQKTTERFSVPVTKAEFAVMRTAFG 286 >gb|ONK56487.1| uncharacterized protein A4U43_C10F9260 [Asparagus officinalis] Length = 345 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 281 AILNSAQKTTERFSVPVTKAEFAVMRTAFG 192 ++LNSAQKTTERFSVPVTKAEFAVMRTAFG Sbjct: 275 SVLNSAQKTTERFSVPVTKAEFAVMRTAFG 304