BLASTX nr result
ID: Ophiopogon27_contig00021684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00021684 (639 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010925624.1| PREDICTED: uncharacterized protein LOC105048... 66 3e-10 gb|PKA51656.1| hypothetical protein AXF42_Ash003023 [Apostasia s... 62 2e-09 gb|OAY84392.1| hypothetical protein ACMD2_02065 [Ananas comosus] 59 2e-08 gb|OAY66762.1| hypothetical protein ACMD2_26146 [Ananas comosus] 59 3e-08 emb|CDP06022.1| unnamed protein product [Coffea canephora] 52 8e-06 gb|PAN32840.1| hypothetical protein PAHAL_E04395 [Panicum hallii] 52 8e-06 ref|XP_004968580.1| eukaryotic translation initiation factor 3 s... 52 9e-06 >ref|XP_010925624.1| PREDICTED: uncharacterized protein LOC105048118 [Elaeis guineensis] Length = 138 Score = 66.2 bits (160), Expect = 3e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 513 MMSEEVGSKLVRFLYFVGAGVICTKGINLYRDSER 409 M+SEEVG+KLVRFLYFVGAGVICTKGINL+RD ER Sbjct: 1 MVSEEVGTKLVRFLYFVGAGVICTKGINLWRDYER 35 >gb|PKA51656.1| hypothetical protein AXF42_Ash003023 [Apostasia shenzhenica] Length = 60 Score = 62.0 bits (149), Expect = 2e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 513 MMSEEVGSKLVRFLYFVGAGVICTKGINLYRDSE 412 M+SEEVG+KL+RFLYFVGAGVICTKGINL+R+ E Sbjct: 1 MVSEEVGNKLLRFLYFVGAGVICTKGINLWREHE 34 >gb|OAY84392.1| hypothetical protein ACMD2_02065 [Ananas comosus] Length = 66 Score = 59.3 bits (142), Expect = 2e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 513 MMSEEVGSKLVRFLYFVGAGVICTKGINLYRDSER 409 M +EVG KLVRFLYFVGAGVICTK INL+RD ER Sbjct: 1 MAGDEVGVKLVRFLYFVGAGVICTKAINLWRDYER 35 >gb|OAY66762.1| hypothetical protein ACMD2_26146 [Ananas comosus] Length = 79 Score = 59.3 bits (142), Expect = 3e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 513 MMSEEVGSKLVRFLYFVGAGVICTKGINLYRDSER 409 M +EVG KLVRFLYFVGAGVICTK INL+RD ER Sbjct: 1 MAGDEVGVKLVRFLYFVGAGVICTKAINLWRDYER 35 >emb|CDP06022.1| unnamed protein product [Coffea canephora] Length = 67 Score = 52.4 bits (124), Expect = 8e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -1 Query: 510 MSEEVGSKLVRFLYFVGAGVICTKGINLYRDSER 409 + EEVG KLVRFLYF+GAG +CT IN +RD ER Sbjct: 7 VGEEVGPKLVRFLYFIGAGFVCTAAINKWRDLER 40 >gb|PAN32840.1| hypothetical protein PAHAL_E04395 [Panicum hallii] Length = 71 Score = 52.4 bits (124), Expect = 8e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -1 Query: 501 EVGSKLVRFLYFVGAGVICTKGINLYRDSE 412 E SKL+RFLYFVGAGVICTK IN YRD E Sbjct: 6 EASSKLLRFLYFVGAGVICTKAINTYRDYE 35 >ref|XP_004968580.1| eukaryotic translation initiation factor 3 subunit D [Setaria italica] Length = 75 Score = 52.4 bits (124), Expect = 9e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -1 Query: 501 EVGSKLVRFLYFVGAGVICTKGINLYRDSE 412 E SKL+RFLYFVGAGVICTK IN YRD E Sbjct: 6 EASSKLLRFLYFVGAGVICTKAINTYRDYE 35