BLASTX nr result
ID: Ophiopogon27_contig00021500
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00021500 (580 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020106347.1| 54S ribosomal protein L37, mitochondrial-lik... 70 5e-12 gb|OAY71797.1| hypothetical protein ACMD2_00802 [Ananas comosus] 70 7e-12 ref|XP_015875550.1| PREDICTED: 39S ribosomal protein L54, mitoch... 69 1e-11 ref|XP_010033374.1| PREDICTED: 39S ribosomal protein L54, mitoch... 69 1e-11 ref|XP_020248853.1| 39S ribosomal protein L54, mitochondrial-lik... 69 2e-11 ref|XP_023880178.1| 54S ribosomal protein L37, mitochondrial-lik... 69 2e-11 gb|POE76035.1| hypothetical protein CFP56_05005 [Quercus suber] 69 2e-11 ref|XP_019154901.1| PREDICTED: 54S ribosomal protein L37, mitoch... 68 3e-11 gb|PIN18377.1| Mitochondrial/chloroplast ribosomal protein L54/L... 68 3e-11 gb|PIN17810.1| Mitochondrial/chloroplast ribosomal protein L54/L... 68 3e-11 ref|XP_010931910.1| PREDICTED: 54S ribosomal protein L37, mitoch... 68 3e-11 ref|XP_010551921.1| PREDICTED: 54S ribosomal protein L37, mitoch... 67 5e-11 ref|XP_021299167.1| 54S ribosomal protein L37, mitochondrial-lik... 67 5e-11 ref|XP_007031752.1| PREDICTED: 54S ribosomal protein L37, mitoch... 67 5e-11 ref|XP_022989738.1| 54S ribosomal protein L37, mitochondrial-lik... 67 6e-11 ref|XP_010922005.1| PREDICTED: 54S ribosomal protein L37, mitoch... 67 6e-11 ref|XP_023530063.1| 54S ribosomal protein L37, mitochondrial-lik... 67 6e-11 ref|XP_017613318.1| PREDICTED: uncharacterized protein LOC108458... 67 7e-11 gb|KJB74600.1| hypothetical protein B456_012G089400 [Gossypium r... 67 7e-11 ref|XP_022038295.1| 54S ribosomal protein L37, mitochondrial-lik... 67 7e-11 >ref|XP_020106347.1| 54S ribosomal protein L37, mitochondrial-like [Ananas comosus] Length = 133 Score = 70.1 bits (170), Expect = 5e-12 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK+T+TLP+EDLKRFVKLD+RARIKEN+A RAKN Sbjct: 95 LSELRRKDTETLPFEDLKRFVKLDNRARIKENNAVRAKN 133 >gb|OAY71797.1| hypothetical protein ACMD2_00802 [Ananas comosus] Length = 147 Score = 70.1 bits (170), Expect = 7e-12 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK+T+TLP+EDLKRFVKLD+RARIKEN+A RAKN Sbjct: 109 LSELRRKDTETLPFEDLKRFVKLDNRARIKENNAVRAKN 147 >ref|XP_015875550.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Ziziphus jujuba] Length = 133 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +1 Query: 1 PLSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 PLSELRRK +TLPYEDLKRFVKLD+RARIKEN++ +AKN Sbjct: 94 PLSELRRKNIETLPYEDLKRFVKLDNRARIKENNSVKAKN 133 >ref|XP_010033374.1| PREDICTED: 39S ribosomal protein L54, mitochondrial [Eucalyptus grandis] ref|XP_010033375.1| PREDICTED: 39S ribosomal protein L54, mitochondrial [Eucalyptus grandis] ref|XP_010033376.1| PREDICTED: 39S ribosomal protein L54, mitochondrial [Eucalyptus grandis] gb|KCW52994.1| hypothetical protein EUGRSUZ_J02294 [Eucalyptus grandis] gb|KCW52995.1| hypothetical protein EUGRSUZ_J02294 [Eucalyptus grandis] Length = 133 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +1 Query: 1 PLSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 PLSELRRK +TLPYEDLKRFVKLD+RARIKEN++ +AKN Sbjct: 94 PLSELRRKNVETLPYEDLKRFVKLDNRARIKENNSIKAKN 133 >ref|XP_020248853.1| 39S ribosomal protein L54, mitochondrial-like [Asparagus officinalis] Length = 150 Score = 69.3 bits (168), Expect = 2e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +1 Query: 1 PLSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 PLSELRRK +TLPYEDLKRFVKLD+R+RIKEN+A +AKN Sbjct: 111 PLSELRRKNVETLPYEDLKRFVKLDNRSRIKENNAVKAKN 150 >ref|XP_023880178.1| 54S ribosomal protein L37, mitochondrial-like [Quercus suber] gb|POE76036.1| hypothetical protein CFP56_05005 [Quercus suber] Length = 131 Score = 68.6 bits (166), Expect = 2e-11 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK+T+TLPYEDLKRFVKLD+RARIKEN++ +AKN Sbjct: 93 LSELRRKKTETLPYEDLKRFVKLDNRARIKENNSLKAKN 131 >gb|POE76035.1| hypothetical protein CFP56_05005 [Quercus suber] Length = 137 Score = 68.6 bits (166), Expect = 2e-11 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK+T+TLPYEDLKRFVKLD+RARIKEN++ +AKN Sbjct: 99 LSELRRKKTETLPYEDLKRFVKLDNRARIKENNSLKAKN 137 >ref|XP_019154901.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Ipomoea nil] Length = 131 Score = 68.2 bits (165), Expect = 3e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK+ +TLPYEDLKRFVKLD+RARIKEN++ RAKN Sbjct: 93 LSELRRKDLETLPYEDLKRFVKLDNRARIKENNSVRAKN 131 >gb|PIN18377.1| Mitochondrial/chloroplast ribosomal protein L54/L37 [Handroanthus impetiginosus] Length = 132 Score = 68.2 bits (165), Expect = 3e-11 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = +1 Query: 1 PLSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 PLSELRRK+ ++LPYEDLKRFVKLD+RARIKEN++ +AKN Sbjct: 93 PLSELRRKDIESLPYEDLKRFVKLDNRARIKENNSVKAKN 132 >gb|PIN17810.1| Mitochondrial/chloroplast ribosomal protein L54/L37 [Handroanthus impetiginosus] Length = 132 Score = 68.2 bits (165), Expect = 3e-11 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = +1 Query: 1 PLSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 PLSELRRK+ ++LPYEDLKRFVKLD+RARIKEN++ +AKN Sbjct: 93 PLSELRRKDIESLPYEDLKRFVKLDNRARIKENNSVKAKN 132 >ref|XP_010931910.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Elaeis guineensis] ref|XP_010931911.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Elaeis guineensis] Length = 133 Score = 68.2 bits (165), Expect = 3e-11 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = +1 Query: 1 PLSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 PLSELRRK+T+TL ++DLKRFVKLD+RARIKEN+A RAKN Sbjct: 94 PLSELRRKDTETLSFDDLKRFVKLDNRARIKENNALRAKN 133 >ref|XP_010551921.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X1 [Tarenaya hassleriana] ref|XP_010551922.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X2 [Tarenaya hassleriana] Length = 130 Score = 67.4 bits (163), Expect = 5e-11 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK+ +TLPY+DLKRFVKLD+RARIKEN++ RAKN Sbjct: 92 LSELRRKDVETLPYDDLKRFVKLDTRARIKENNSVRAKN 130 >ref|XP_021299167.1| 54S ribosomal protein L37, mitochondrial-like [Herrania umbratica] Length = 131 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK +TLPYEDLKRFVKLD+RARIKEN+A +AKN Sbjct: 93 LSELRRKNIETLPYEDLKRFVKLDNRARIKENNAVKAKN 131 >ref|XP_007031752.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Theobroma cacao] ref|XP_007031754.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Theobroma cacao] ref|XP_017974164.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Theobroma cacao] ref|XP_017974165.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Theobroma cacao] gb|EOY02676.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gb|EOY02677.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gb|EOY02678.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gb|EOY02679.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gb|EOY02680.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] Length = 131 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK +TLPYEDLKRFVKLD+RARIKEN+A +AKN Sbjct: 93 LSELRRKNIETLPYEDLKRFVKLDNRARIKENNAVKAKN 131 >ref|XP_022989738.1| 54S ribosomal protein L37, mitochondrial-like [Cucurbita maxima] ref|XP_022989739.1| 54S ribosomal protein L37, mitochondrial-like [Cucurbita maxima] Length = 132 Score = 67.4 bits (163), Expect = 6e-11 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK+ +TLPYEDLKRFVKLD+RARIKEN++++AKN Sbjct: 94 LSELRRKDAKTLPYEDLKRFVKLDTRARIKENNSSKAKN 132 >ref|XP_010922005.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Elaeis guineensis] Length = 133 Score = 67.4 bits (163), Expect = 6e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +1 Query: 1 PLSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 PLSELRRK T+TL ++DLKRFVKLD+RARIKEN+A RAKN Sbjct: 94 PLSELRRKNTETLTFDDLKRFVKLDNRARIKENNALRAKN 133 >ref|XP_023530063.1| 54S ribosomal protein L37, mitochondrial-like [Cucurbita pepo subsp. pepo] Length = 134 Score = 67.4 bits (163), Expect = 6e-11 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK+ +TLPYEDLKRFVKLD+RARIKEN++++AKN Sbjct: 96 LSELRRKDAKTLPYEDLKRFVKLDTRARIKENNSSKAKN 134 >ref|XP_017613318.1| PREDICTED: uncharacterized protein LOC108458435 [Gossypium arboreum] Length = 126 Score = 67.0 bits (162), Expect = 7e-11 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK+ +TLPYEDLKRFVKLD+RARIKEN++ +AKN Sbjct: 88 LSELRRKDIETLPYEDLKRFVKLDNRARIKENNSVKAKN 126 >gb|KJB74600.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 126 Score = 67.0 bits (162), Expect = 7e-11 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK+ +TLPYEDLKRFVKLD+RARIKEN++ +AKN Sbjct: 88 LSELRRKDIETLPYEDLKRFVKLDNRARIKENNSVKAKN 126 >ref|XP_022038295.1| 54S ribosomal protein L37, mitochondrial-like [Helianthus annuus] Length = 128 Score = 67.0 bits (162), Expect = 7e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 4 LSELRRKETQTLPYEDLKRFVKLDSRARIKENSAARAKN 120 LSELRRK +TLPYEDLKRFVKLD+RARIKEN+ RAKN Sbjct: 90 LSELRRKNIETLPYEDLKRFVKLDNRARIKENNTTRAKN 128