BLASTX nr result
ID: Ophiopogon27_contig00021180
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00021180 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253938.1| uncharacterized protein LOC109831005 [Aspara... 42 2e-07 ref|XP_020265674.1| uncharacterized protein LOC109841186 [Aspara... 42 2e-07 >ref|XP_020253938.1| uncharacterized protein LOC109831005 [Asparagus officinalis] Length = 730 Score = 42.4 bits (98), Expect(2) = 2e-07 Identities = 21/33 (63%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +2 Query: 278 SLH*IGYYLNPYFYY-FKEKIEKTKTFMDSLIE 373 SLH GYYLNPYFYY +IEK TFM SL++ Sbjct: 475 SLHKAGYYLNPYFYYPAYTEIEKDGTFMTSLVD 507 Score = 40.4 bits (93), Expect(2) = 2e-07 Identities = 22/38 (57%), Positives = 26/38 (68%), Gaps = 5/38 (13%) Frame = +1 Query: 61 NKKL*DNTNFALKVFAPLMKVLRTINGDSV-----IYG 159 + K DNT+FALKVF PL+KVLR +GD V IYG Sbjct: 400 SNKFWDNTDFALKVFNPLVKVLRRADGDKVPSMGFIYG 437 >ref|XP_020265674.1| uncharacterized protein LOC109841186 [Asparagus officinalis] Length = 685 Score = 42.4 bits (98), Expect(2) = 2e-07 Identities = 21/33 (63%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +2 Query: 278 SLH*IGYYLNPYFYY-FKEKIEKTKTFMDSLIE 373 SLH GYYLNPYFYY +IEK TFM SL++ Sbjct: 507 SLHKAGYYLNPYFYYPAYTEIEKDGTFMTSLVD 539 Score = 40.0 bits (92), Expect(2) = 2e-07 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 5/38 (13%) Frame = +1 Query: 61 NKKL*DNTNFALKVFAPLMKVLRTINGDSV-----IYG 159 + K DNT+FALK+F PL+KVLR +GD V IYG Sbjct: 432 SNKFWDNTDFALKIFNPLVKVLRRADGDKVPSMGFIYG 469