BLASTX nr result
ID: Ophiopogon27_contig00021168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00021168 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018681063.1| PREDICTED: splicing factor U2af large subuni... 54 8e-06 >ref|XP_018681063.1| PREDICTED: splicing factor U2af large subunit B-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 613 Score = 53.9 bits (128), Expect = 8e-06 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = +1 Query: 1 MPGVTLPDNVGQLVPLCCQWA*APTSVALMSKEESMPRFDGSCSSSAGN 147 +PG T NVG LVPLCCQ A S+A M K+E +FDGSCSSS G+ Sbjct: 188 LPGATATGNVGPLVPLCCQRVRA-DSLAFMCKKEPTHQFDGSCSSSIGS 235