BLASTX nr result
ID: Ophiopogon27_contig00020780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00020780 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265678.1| aberrant root formation protein 4 isoform X1... 59 4e-07 >ref|XP_020265678.1| aberrant root formation protein 4 isoform X1 [Asparagus officinalis] gb|ONK70397.1| uncharacterized protein A4U43_C05F33290 [Asparagus officinalis] Length = 589 Score = 58.5 bits (140), Expect = 4e-07 Identities = 34/48 (70%), Positives = 35/48 (72%) Frame = -2 Query: 435 LTMGIQAEN*KDGDELALADSTHCALAPVRLVLH*CIELVEEKLNHSV 292 LTMGIQA N ELA D CALAPV+LVLH CIELVEEKL HSV Sbjct: 544 LTMGIQAGNESGCGELA--DGILCALAPVQLVLHRCIELVEEKLKHSV 589