BLASTX nr result
ID: Ophiopogon27_contig00020505
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00020505 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242734.1| metal tolerance protein C2 [Asparagus offici... 80 3e-15 >ref|XP_020242734.1| metal tolerance protein C2 [Asparagus officinalis] gb|ONK79818.1| uncharacterized protein A4U43_C01F10440 [Asparagus officinalis] Length = 401 Score = 80.5 bits (197), Expect = 3e-15 Identities = 44/76 (57%), Positives = 51/76 (67%), Gaps = 1/76 (1%) Frame = -2 Query: 230 MESNGTETXXXXXXXPRSASFNHRHWNG-DYGLSSNDXXXXXXXXXXXRYADPQSPVAIQ 54 MESNG+ + S+S NHRHWNG DYGLS ND R+ DPQSP+++Q Sbjct: 1 MESNGSGSTPKFPPPKTSSS-NHRHWNGGDYGLSVNDRRVAFSRNPSFRHPDPQSPISVQ 59 Query: 53 RSNSFRPNLSRSDSSI 6 RSNSFRPNLSRSDSSI Sbjct: 60 RSNSFRPNLSRSDSSI 75