BLASTX nr result
ID: Ophiopogon27_contig00020504
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00020504 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK77424.1| uncharacterized protein A4U43_C02F6380 [Asparagus... 65 2e-09 ref|XP_020253783.1| LOW QUALITY PROTEIN: probable protein phosph... 65 4e-09 ref|XP_020426436.1| probable protein phosphatase 2C 11 isoform X... 63 2e-08 ref|XP_022993913.1| probable protein phosphatase 2C 11 isoform X... 62 2e-08 gb|ONH89745.1| hypothetical protein PRUPE_8G013300 [Prunus persica] 63 2e-08 ref|XP_016650937.1| PREDICTED: probable protein phosphatase 2C 1... 63 2e-08 ref|XP_022869121.1| probable protein phosphatase 2C 11 [Olea eur... 63 2e-08 ref|XP_007200403.1| probable protein phosphatase 2C 11 isoform X... 63 2e-08 ref|XP_016650936.1| PREDICTED: probable protein phosphatase 2C 1... 63 2e-08 ref|XP_023549663.1| probable protein phosphatase 2C 11 [Cucurbit... 62 3e-08 ref|XP_022993912.1| probable protein phosphatase 2C 11 isoform X... 62 3e-08 ref|XP_022938792.1| probable protein phosphatase 2C 11 [Cucurbit... 62 3e-08 ref|XP_016899381.1| PREDICTED: probable protein phosphatase 2C 1... 62 3e-08 ref|XP_015888495.1| PREDICTED: probable protein phosphatase 2C 1... 62 3e-08 ref|XP_015942354.2| probable protein phosphatase 2C 11 [Arachis ... 62 4e-08 ref|XP_016176084.1| probable protein phosphatase 2C 11 [Arachis ... 62 4e-08 ref|XP_021818907.1| probable protein phosphatase 2C 11 [Prunus a... 62 4e-08 ref|XP_015888494.1| PREDICTED: probable protein phosphatase 2C 1... 62 4e-08 ref|XP_019250710.1| PREDICTED: probable protein phosphatase 2C 1... 62 4e-08 ref|XP_009768442.1| PREDICTED: probable protein phosphatase 2C 1... 62 4e-08 >gb|ONK77424.1| uncharacterized protein A4U43_C02F6380 [Asparagus officinalis] Length = 277 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 92 AIPLSIDHKPERSDERERIESAGGFILWAG 3 AIPLSIDHKPERSDERERIESAGGFILWAG Sbjct: 152 AIPLSIDHKPERSDERERIESAGGFILWAG 181 >ref|XP_020253783.1| LOW QUALITY PROTEIN: probable protein phosphatase 2C 11 [Asparagus officinalis] Length = 499 Score = 65.1 bits (157), Expect = 4e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 92 AIPLSIDHKPERSDERERIESAGGFILWAG 3 AIPLSIDHKPERSDERERIESAGGFILWAG Sbjct: 369 AIPLSIDHKPERSDERERIESAGGFILWAG 398 >ref|XP_020426436.1| probable protein phosphatase 2C 11 isoform X2 [Prunus persica] Length = 283 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 SRIQGF*YFTAIPLSIDHKPERSDERERIESAGGFILWAG 3 SR+ G +AIPLSIDHKP+RSDER+RIE AGGFI+WAG Sbjct: 190 SRVVGCRAGSAIPLSIDHKPDRSDERQRIEEAGGFIIWAG 229 >ref|XP_022993913.1| probable protein phosphatase 2C 11 isoform X2 [Cucurbita maxima] Length = 228 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 +AIPLSIDHKP+RSDERERIE AGGFI+WAG Sbjct: 149 SAIPLSIDHKPDRSDERERIEQAGGFIIWAG 179 >gb|ONH89745.1| hypothetical protein PRUPE_8G013300 [Prunus persica] Length = 310 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 SRIQGF*YFTAIPLSIDHKPERSDERERIESAGGFILWAG 3 SR+ G +AIPLSIDHKP+RSDER+RIE AGGFI+WAG Sbjct: 174 SRVVGCRAGSAIPLSIDHKPDRSDERQRIEEAGGFIIWAG 213 >ref|XP_016650937.1| PREDICTED: probable protein phosphatase 2C 11 isoform X2 [Prunus mume] Length = 320 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 SRIQGF*YFTAIPLSIDHKPERSDERERIESAGGFILWAG 3 SR+ G +AIPLSIDHKP+RSDER+RIE AGGFI+WAG Sbjct: 191 SRVVGCRAGSAIPLSIDHKPDRSDERQRIEDAGGFIIWAG 230 >ref|XP_022869121.1| probable protein phosphatase 2C 11 [Olea europaea var. sylvestris] Length = 324 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 +AIPLSIDHKP+RSDERERIE AGGFILWAG Sbjct: 210 SAIPLSIDHKPDRSDERERIEQAGGFILWAG 240 >ref|XP_007200403.1| probable protein phosphatase 2C 11 isoform X1 [Prunus persica] ref|XP_020426435.1| probable protein phosphatase 2C 11 isoform X1 [Prunus persica] Length = 326 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 SRIQGF*YFTAIPLSIDHKPERSDERERIESAGGFILWAG 3 SR+ G +AIPLSIDHKP+RSDER+RIE AGGFI+WAG Sbjct: 190 SRVVGCRAGSAIPLSIDHKPDRSDERQRIEEAGGFIIWAG 229 >ref|XP_016650936.1| PREDICTED: probable protein phosphatase 2C 11 isoform X1 [Prunus mume] Length = 327 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 SRIQGF*YFTAIPLSIDHKPERSDERERIESAGGFILWAG 3 SR+ G +AIPLSIDHKP+RSDER+RIE AGGFI+WAG Sbjct: 191 SRVVGCRAGSAIPLSIDHKPDRSDERQRIEDAGGFIIWAG 230 >ref|XP_023549663.1| probable protein phosphatase 2C 11 [Cucurbita pepo subsp. pepo] Length = 275 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 +AIPLSIDHKP+RSDERERIE AGGFI+WAG Sbjct: 149 SAIPLSIDHKPDRSDERERIEQAGGFIIWAG 179 >ref|XP_022993912.1| probable protein phosphatase 2C 11 isoform X1 [Cucurbita maxima] Length = 275 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 +AIPLSIDHKP+RSDERERIE AGGFI+WAG Sbjct: 149 SAIPLSIDHKPDRSDERERIEQAGGFIIWAG 179 >ref|XP_022938792.1| probable protein phosphatase 2C 11 [Cucurbita moschata] Length = 275 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 +AIPLSIDHKP+RSDERERIE AGGFI+WAG Sbjct: 149 SAIPLSIDHKPDRSDERERIEQAGGFIIWAG 179 >ref|XP_016899381.1| PREDICTED: probable protein phosphatase 2C 11 isoform X2 [Cucumis melo] Length = 243 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 +AIPLSIDHKP+RSDER+RIE AGGFILWAG Sbjct: 149 SAIPLSIDHKPDRSDERQRIEQAGGFILWAG 179 >ref|XP_015888495.1| PREDICTED: probable protein phosphatase 2C 11 isoform X3 [Ziziphus jujuba] ref|XP_015888500.1| PREDICTED: probable protein phosphatase 2C 11 isoform X3 [Ziziphus jujuba] Length = 312 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 +AIPLSIDHKP+RSDERERIE AGGFI+WAG Sbjct: 210 SAIPLSIDHKPDRSDERERIEQAGGFIIWAG 240 >ref|XP_015942354.2| probable protein phosphatase 2C 11 [Arachis duranensis] ref|XP_020987137.1| probable protein phosphatase 2C 11 [Arachis duranensis] ref|XP_020987138.1| probable protein phosphatase 2C 11 [Arachis duranensis] Length = 313 Score = 62.0 bits (149), Expect = 4e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 TA+PLSIDHKP+RSDER+RIE AGGFI+WAG Sbjct: 187 TAVPLSIDHKPDRSDERQRIEEAGGFIIWAG 217 >ref|XP_016176084.1| probable protein phosphatase 2C 11 [Arachis ipaensis] Length = 313 Score = 62.0 bits (149), Expect = 4e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 TA+PLSIDHKP+RSDER+RIE AGGFI+WAG Sbjct: 187 TAVPLSIDHKPDRSDERQRIEEAGGFIIWAG 217 >ref|XP_021818907.1| probable protein phosphatase 2C 11 [Prunus avium] Length = 571 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 122 SRIQGF*YFTAIPLSIDHKPERSDERERIESAGGFILWAG 3 SR+ G +AIPLS+DHKP+RSDER+RIE AGGFI+WAG Sbjct: 435 SRVVGCRAGSAIPLSVDHKPDRSDERQRIEEAGGFIIWAG 474 >ref|XP_015888494.1| PREDICTED: probable protein phosphatase 2C 11 isoform X2 [Ziziphus jujuba] ref|XP_015888499.1| PREDICTED: probable protein phosphatase 2C 11 isoform X2 [Ziziphus jujuba] Length = 329 Score = 62.0 bits (149), Expect = 4e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 +AIPLSIDHKP+RSDERERIE AGGFI+WAG Sbjct: 203 SAIPLSIDHKPDRSDERERIEQAGGFIIWAG 233 >ref|XP_019250710.1| PREDICTED: probable protein phosphatase 2C 11 [Nicotiana attenuata] ref|XP_019250711.1| PREDICTED: probable protein phosphatase 2C 11 [Nicotiana attenuata] gb|OIT01360.1| putative protein phosphatase 2c 11 [Nicotiana attenuata] Length = 330 Score = 62.0 bits (149), Expect = 4e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 +AIPLSIDHKP+RSDERERIE AGGFI+WAG Sbjct: 204 SAIPLSIDHKPDRSDERERIEQAGGFIIWAG 234 >ref|XP_009768442.1| PREDICTED: probable protein phosphatase 2C 11 [Nicotiana sylvestris] ref|XP_016468940.1| PREDICTED: probable protein phosphatase 2C 11 isoform X2 [Nicotiana tabacum] Length = 330 Score = 62.0 bits (149), Expect = 4e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 TAIPLSIDHKPERSDERERIESAGGFILWAG 3 +AIPLSIDHKP+RSDERERIE AGGFI+WAG Sbjct: 204 SAIPLSIDHKPDRSDERERIEQAGGFIIWAG 234